CAZyme Information: FFUJ_05368-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_05368-t31_1-p1
• CAZy Family: CE5
• CAZyme Description: related to beta-hexosaminidase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
561		62525.46	5.8452

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679028:114727-116904(+)

Full Sequence      

MSLYVSAGYLDRMNPQMMLLSTSAVVQMLLVMRMIPFPKSVTNGNATTEVAGLQTTNSID
SSLSDEEYILDVGYQQDGAVSIRGGSPSGIFYGLQTFKQLLPPSSLRHTKSAGEGLWALS
TQTIHDTPRFAWRGVMLDVARHFMPLPDLLRFIDLLAFHKLNVLHLHLTDDQGWRLPVAK
WPELTTVACWRKRTMQGAPPHGKLDSRPHGGYYSREDLEELVAFATERHIRVVPEIDMPG
HMQAAVAAYPELGNGAQVVVMEEWGISKHVLNMSDKALEFCKDVLDTVCDIFPGEFIGIG
GDECPHDEWKANPDSQSKMKQLGLADEAGLHEWFIGQMAAHLHVHGRRPYGWDELMGCGD
KVPKDVLIAAWRGIEPTEIAAKSGFEVIACPDIKCYLDYRQSEDKNEPTPVGVVLSLEDI
YNFDPVPEGLTQDEKEKVMGTQVNVWTEHMESASRVIYMVFPRLCAFAEVAWGKADNHSD
IGDFQVRLEQHLPRLEALGVNYRPLKGPRPWNARPDAPGHPGKIAGGNSLSPPISVSCLM
EFIVHGLMISRQEQKCSTRHN

Enzyme Prediction     

EC	3.2.1.52:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	125	474	2e-114	0.973293768545994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119333	GH20_chitobiase-like	1.31e-171	130	488	1	357	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
395590	Glyco_hydro_20	1.01e-144	130	472	1	343	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
226056	Chb	4.80e-115	51	520	191	655	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
119336	GH20_SpHex_like	3.15e-85	130	488	1	329	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.
119338	GH20_chitobiase-like_1	1.76e-74	130	488	1	311	A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This subgroup lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT69480.1|GH20	0.0	1	561	1	561
QGI65309.1|GH20	0.0	18	518	1	501
QGI82557.1|GH20|GH93	0.0	26	518	384	876
QGI96190.1|GH20|GH93	0.0	26	518	384	876
UNI23976.1|GH20	1.67e-212	32	521	1	497

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3RCN_A	2.39e-152	59	519	71	530	Crystal Structure of Beta-N-Acetylhexosaminidase from Arthrobacter aurescens [Paenarthrobacter aurescens TC1]
6Q63_A	5.42e-103	51	502	86	536	BT0459 [Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]
7CBN_A	2.34e-102	60	518	72	521	Crystal structure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila [Akkermansia muciniphila ATCC BAA-835],7CBO_A Crystal structure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila in complex with GlcNAc [Akkermansia muciniphila ATCC BAA-835]
7DUP_A	3.83e-87	45	502	58	520	Chain A, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_A Chain A, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
7DVB_A	2.09e-86	45	502	58	520	Chain A, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_C Chain C, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_D Chain D, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2UQG6|H0868_AKKM8	1.64e-101	60	518	91	540	Beta-hexosaminidase Amuc_0868 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0868 PE=1 SV=1
sp|P49008|HEXA_PORGI	3.02e-89	63	502	108	532	Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=nahA PE=3 SV=2
sp|P96155|HEX1_VIBFU	1.58e-64	62	468	204	601	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1
sp|B2UP57|H2018_AKKM8	1.78e-64	82	472	71	447	Beta-hexosaminidase Amuc_2018 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2018 PE=1 SV=1
sp|Q7WUL4|HEX20_CELFI	6.06e-55	58	502	74	477	Beta-N-acetylhexosaminidase OS=Cellulomonas fimi OX=1708 GN=hex20 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000017	0.000020

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_05368-t31_1-p1.