CAZyme Information: FFUJ_05366-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_05366-t31_1-p1
• CAZy Family: CE5
• CAZyme Description: related to beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
747		81771.31	5.6163

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679028:110346-112589(-)

Full Sequence      

MKSVILTIQAHQHQAHDHEISQPLTFDKAVKEVEQGQDSSAVAIRLLAEMSSAERLHLLY
GDVPFWEGLREILCDRYNRRPFVMGAIPRLNIPGVKFTDGPRGIVMGSSTAFPIAMARGA
TWDIDLERRVGNAIGLEGKAQGANLFAGVCINLPRHPAWGRIQETYGEDPILLGEFGTAL
TQGVQNHIMACVKHFALNSIENARFRVDVQVDEDVLHEVYLAHFKRVIEAGVASVMSSYN
SVNGEWAGQSRLLLTEILRDQWNFAGFVMSDFIFGLRDAAISLKNGLDIEAPFAQQRAMH
LNDALKSGGISSVDVGKAAMNILRTKLEFGSLLVQEAPDASVVFCEEHRQLAREVAGRSM
VLLKNDHIHGNPILPLKTETLSRLAVVGRLANKPNTGDKGSSQVFSPTIVTPYQGLKSEI
LSAEVILEDSDNPEAAREAAKQADVAVVIVGYDAGDEGEYVVPSLQNDPCLSELFPPTSN
PGEEEMLSIVQGNPAQGKQESALEVGAGGDRRSLRLRPRDVQVINAVASVNSHTIVMLVC
AGAVIMEEWKGKAPAILVSWYAGAEGGHALADVLLGRVDTGGRLPFSIPKDESHLPELDI
EASSIKYDRWYGQALLDKLGVDAAFPLGYGLSYTQFRFRNLECVYLTEQRIINVALDVEN
IGLRSGHDVAQVYGYPKMAEFPHRVLLGFGSVYLQSRESRRICIEASLRPIERWVNGKFC
LLVSSVEIEVAGHAGDKEAIRKVCNLC

Enzyme Prediction     

No EC number prediction in FFUJ_05366-t31_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	86	290	2.1e-59	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	9.83e-69	37	702	32	721	beta-glucosidase BglX.
224389	BglX	9.68e-62	86	421	54	388	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	1.72e-53	85	704	74	740	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	4.80e-49	360	633	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.73e-39	89	324	63	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT69478.1|GH3	0.0	1	747	1	747
QGI96189.1|GH3	0.0	1	747	1	747
QGI65307.1|GH3	0.0	1	747	1	747
QGI82556.1|GH3	0.0	1	747	1	758
QKD58937.1|GH3	0.0	1	746	1	751

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	5.07e-74	41	723	2	653	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	5.45e-67	46	715	7	688	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	7.09e-66	46	715	7	688	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
5WAB_A	7.57e-61	92	714	37	630	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	1.54e-59	45	716	8	804	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P14002|BGLB_ACET2	2.61e-73	41	723	2	653	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
sp|P27034|BGLS_RHIRD	5.91e-69	46	730	5	802	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|A7LXS8|BGH3A_BACO1	2.40e-67	62	732	43	739	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
sp|Q5BFG8|BGLB_EMENI	1.43e-63	46	736	14	829	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|F6C6C1|APY_BIFBA	6.98e-62	92	714	37	639	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000013

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_05366-t31_1-p1.