CAZyme Information: FFUJ_04743-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_04743-t31_1-p1
• CAZy Family: CE3
• CAZyme Description: related to mixed-linked glucanase precursor MLG1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
852		89169.28	3.9638

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679024:1743593-1746362(-)

Full Sequence      

MAYSLTTSFLGESLISGFDWFNGRDLSNGFVQYQDLEGAEQYGLYSVDPFSNTVRLRPDS
ARKFDLDQGRPSIRLESKESYQYGLFIADFQHIPISQCGTWPAFWAYGANWPNNGEVDIL
EGANLAYTNIMSAHTADGCMLDPADSNLFSGNPQSLDCAVGTDNVGCGFTPPASDTSSYG
DGFNAVGGGVYAMEWDSEYISIWHFPRGAIPADIEAKRPDPRKWGLPQSLFGGSKCNVDQ
YFNDMRIVLNINFCGDYGEGTWGSSETCRALAPTCREYVANNPLDFQDAYFDVSYIDVYT
RLGGDAPPVVPSSTGEAPTEISIPSASTPGPNTSISGNTRFPNSTAIVTRPQPKEDESIT
AEPTTTTTLTGISSVEVTIPGSGTNSATVSSLPVATGGSSVNPAKIDDYAYLGCFGSQTG
FQTFNEKAESDDMTIEKCIEACNGLTYIGLFEGTCYCASKLDADTRALRNESSCNRPCPG
DDDQFCGGMVSRRSKRSIPLRRDAPNNILLTVYADTSDAGQPDVPPGMGPGVNGTAAGGS
SSPTGGSGQGSSPADGVDGSTGSESQAGDSARETANGQAGSGDDSPAATNNGVIVDTATV
TDVVAGTDADAVVFSTWSGGEVIEATQAIPDTVVTSTITFFTVLPTNSGSLVPQESIVTM
SYSLCDYCDTPTLIQPAMATKVVECDGCGINGENTVTLTVPVHVTVTVTGAGTNATQATG
NAAAGVFPDQTREIPPIVPTGMGSNADAGPEVTTIVITYLTTQLVTYGTETNSVSTETRT
LRRTVVLTVSDIETMSILPVPSPGRPNTPISHATPTPGASGAPAVVSSASSRVDDFFVYF
AIVAMAILALSL

Enzyme Prediction     

No EC number prediction in FFUJ_04743-t31_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	51	279	1.7e-79	0.9563318777292577

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185690	GH16_fungal_Lam16A_glucanase	1.72e-136	2	300	1	293	fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Group of fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Lam16A belongs to the 'nonspecific' 1,3(4)-beta-glucanase subfamily, although beta-1,6 branching and beta-1,4 bonds specifically define where Lam16A hydrolyzes its substrates, like curdlan (beta-1,3-glucan), lichenin (beta-1,3-1,4-mixed linkage glucan), and laminarin (beta-1,6-branched-1,3-glucan).
396406	WSC	2.62e-15	412	488	1	80	WSC domain. This domain may be involved in carbohydrate binding.
185693	GH16_laminarinase_like	3.79e-11	37	200	27	172	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
214616	WSC	1.25e-06	408	488	1	85	present in yeast cell wall integrity and stress response component proteins. Domain present in WSC proteins, polycystin and fungal exoglucanase
185691	GH16_Strep_laminarinase_like	4.91e-05	94	196	101	182	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT64076.1|GH16_1	0.0	1	852	1	852
QGI77567.1|GH16_1	0.0	1	852	1	852
QGI91274.1|GH16_1	0.0	1	852	1	852
QGI60369.1|GH16_1	0.0	1	852	1	852
QKD52728.1|GH16_1	0.0	11	852	397	1243

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVV_A	5.27e-69	2	300	2	298	Crystal structure and characterization an elongating GH family 16 beta-1,3-glucosyltransferase [Paecilomyces sp. 'thermophila'],5JVV_B Crystal structure and characterization an elongating GH family 16 beta-1,3-glucosyltransferase [Paecilomyces sp. 'thermophila']
3WDU_A	1.31e-65	11	299	11	295	The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_B The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_C The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_D The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila']
3WDT_A	1.35e-65	11	299	12	296	The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_B The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_C The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_D The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDV_A The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_B The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_C The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_D The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila']
3WDY_A	9.00e-65	11	299	10	294	The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_B The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_C The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_D The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila']
3WDW_A	9.56e-65	11	299	12	296	The apo-form structure of E113A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDW_B The apo-form structure of E113A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDX_A The complex structure of E113A with glucotriose [Paecilomyces sp. 'thermophila'],3WDX_B The complex structure of E113A with glucotriose [Paecilomyces sp. 'thermophila']

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9USW3|YHZ7_SCHPO	1.32e-69	3	299	129	417	Probable glycosidase C21B10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC21B10.07 PE=3 SV=1
sp|D4AJR9|EGLX_ARTBC	9.68e-69	3	307	20	320	Endo-1,3(4)-beta-glucanase ARB_04519 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04519 PE=3 SV=1
sp|A1C7B5|EGLX_ASPCL	2.00e-64	2	312	32	340	Probable endo-1,3(4)-beta-glucanase ACLA_073210 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=ACLA_073210 PE=3 SV=1
sp|Q5BAP5|EGLX_EMENI	4.03e-64	3	306	29	329	Endo-1,3(4)-beta-glucanase xgeA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xgeA PE=3 SV=1
sp|Q4X084|EGLX_ASPFU	6.10e-63	3	299	32	326	Probable endo-1,3(4)-beta-glucanase AFUA_2G14360 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_2G14360 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999929	0.000109

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_04743-t31_1-p1.