CAZyme Information: FFUJ_04520-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_04520-t31_1-p1
• CAZy Family: CE16
• CAZyme Description: related to DFG5 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473		51816.07	4.6533

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679024:2561947-2563414(+)

Full Sequence      

MKLLALASLASVAIATKTPPSSLDTANPDSIRDVAGTLAFDAMKYYSGNTSSVPKDLGDL
QDPYYWWVAGALWGVMLDYYHLTGDYSYNDVVIQALLGPTNLGAGKDYMPAEHADEEGND
DLFFWGSAVLSAAERNFPQPNKNLPSWLDISINVFNELAGRWNTTACGGGLLWQIYPSNP
NGMTYKNSVSNGGFFQLAARLARITGDNKYLDWALKIWDWSWEVGFIDHRNYHVYDGASV
EDNCQKTTYHSFTYTSGIYLYGAAVLANYTEKPEWVDRSKRLLEGTDWFFSPFPNATNVM
YEAACETVNTCNDDMSTFKGYLARFMYLSIQMQPALKEHVHAHLLPSAKAAVQTCTGGKS
GRECGMRWYNSGFDGNPGLGQQMCALEAVQGLLLSDAPAPLKGDDVKVVRSTDWAAMEKD
DSKIKSTPTSSSETSSATAAQPTKSEDAASIPRADLVLASVSIGSVLVFLGWA

Enzyme Prediction     

No EC number prediction in FFUJ_04520-t31_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	29	396	2.4e-90	0.9329608938547486

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	9.97e-151	30	386	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	1.19e-08	64	334	44	282	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
399891	GlcNAc_2-epim	7.82e-04	198	237	285	326	N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase). This family contains a number of eukaryotic and bacterial N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase) enzymes (EC:5.3.1.8) approximately 500 residues long. This converts N-acyl-D-glucosamine to N-acyl-D-mannosamine.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI77779.1|GH76	0.0	1	473	1	473
CCT64273.1|GH76	0.0	1	473	1	473
QGI60584.1|GH76	0.0	1	473	1	473
QGI91486.1|GH76	0.0	1	473	1	473
QKD52958.1|GH76	0.0	1	473	1	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	7.90e-91	29	400	34	410	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]
3K7X_A	1.08e-06	65	281	45	240	Chain A, Lin0763 protein [Listeria innocua]
4BOK_A	3.28e-06	67	277	39	232	Chain A, Alpha-1,6-mannanase [Niallia circulans]
4BOJ_A	3.32e-06	67	277	42	235	Chain A, Alpha-1,6-mannanase [Niallia circulans],4BOJ_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4BOJ_C Chain C, Alpha-1,6-mannanase [Niallia circulans]
4D4A_A	3.50e-06	67	277	60	253	Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4A_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4B_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4B_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4C_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4C_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4D_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4D_B Chain B, Alpha-1,6-mannanase [Niallia circulans],5N0F_A Chain A, Alpha-1,6-mannanase [Niallia circulans],5N0F_B Chain B, Alpha-1,6-mannanase [Niallia circulans],6ZBX_A Chain A, Alpha-1,6-mannanase [Niallia circulans],6ZBX_B Chain B, Alpha-1,6-mannanase [Niallia circulans],7NL5_A Chain A, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	5.82e-110	9	405	9	397	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	4.78e-105	23	389	21	378	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	3.12e-101	22	400	23	394	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q5AD78|DCW1_CANAL	5.08e-100	23	404	21	399	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	1.45e-93	27	394	25	385	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000396	0.999579	CS pos: 15-16. Pr: 0.9803

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_04520-t31_1-p1.