CAZyme Information: FFUJ_04226-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_04226-t31_1-p1
• CAZy Family: GT90
• CAZyme Description: uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
486	HF679024|CGC18	55682.60	8.5945

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679024:3637406-3638866(+)

Full Sequence      

MGFKLQAAGPGAIVSIVLLSIIVAIRITGFIALQYGRWKYQHYNGRLNGSNKISVILTIS
DSKDRNLVDYVRTILKNKPEQLLITTSNRKAQHRVDGKLKGLRFAYSDTKISVGAVNEPN
RRREIDHALASIDTPFTVLTDQGVYWPEGFLKSAMIPFASHRVGCVTVPMMARKRDGIWG
SFWTCLFSCYYSLMAERNRALNALDSSILFTGSPIIFRTKLTAQPRFKQQFEVEPCLNRR
HGVHKADEYLFFNRYLLQEEAPREEPCLVVFQDTPEATVVVDRPTIAEFISEYLQMTRNL
WRLSRVMIRRKERNQYPCAFLLTHLSSFVSFPLMYEILFFLLVHFTIHLGDDEWAAWIIF
GYSLAFFLTVVGSQIFRRFVVGGGYGFGIVTPIMAVLVCYPAYYILGLLRLVALATAWKA
DVELINEDEIKVRVGDPEALRYSVHGAEEARADIDEPPWISGCMELERPWRALRPLSDFQ
LYTIEE

Enzyme Prediction     

No EC number prediction in FFUJ_04226-t31_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133056	GT2_HAS	5.08e-13	53	221	2	163	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI78058.1|GT0	0.0	1	486	1	486
QGI91772.1|GT0	0.0	1	486	1	486
QGI60871.1|GT0	0.0	1	486	1	486
QKD53257.1|GT0	1.81e-251	1	486	1	486
QPC72485.1|GT0	6.30e-60	11	428	10	434

PDB Hits     

FFUJ_04226-t31_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1RB03|GT2_GIBZE	1.12e-10	50	336	74	351	Type 2 glycosyltransferase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GT2 PE=2 SV=1
sp|F9WWD1|GT2_ZYMTI	1.60e-08	49	302	44	282	Type 2 glycosyltransferase OS=Zymoseptoria tritici (strain CBS 115943 / IPO323) OX=336722 GN=GT2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999984	0.000074

TMHMM  Annotations     

Start	End
11	33
317	339
354	376
383	405