CAZyme Information: FFUJ_03894-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_03894-t31_1-p1
• CAZy Family: GT71
• CAZyme Description: uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
298	HF679024|CGC7	32211.43	4.9837

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679024:4520236-4521132(+)

Full Sequence      

MHLVAFMAASLAIQLPYALATPHRRDVKCENKTNPLPGQTCAIFAEDWNMTLNEFKALNP
GVECPDLDPVGSYCVKGTADKDEPAGVGSKTAKPTSVTEPTEPSYGEMPDAPFDVESFSI
PNADDESSAEPTVPQKPSPVDECCGNGIQTPKPIQQGMVANCNKFHYIESTTTCQGVLDR
YKISLADFIKWNPAVGEDCTNMWAGTNACVRVKGYTSSATRDIKPNPVADNQSATPSPVQ
AGLVKNCVKFHYIGPGTTCQEVLHHYKITMAQFAQWNPAVGEDCKTLWKGTYVCVAAV

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
197609	LysM	7.68e-04	250	295	1	44	Lysin motif.
411384	Streccoc_I_II	0.009	56	140	850	935	antigen I/II family LPXTG-anchored adhesin. Members of the antigen I/II family are adhesins with a glucan-binding domain, two types of repetitive regions, an isopeptide bond-forming domain associated with shear resistance, and a C-terminal LPXTG motif for anchoring to the cell wall. They occur in oral Streptococci, and tend to be major cell surface adhesins. Members of this family include SspA and SspB from Streptococcus gordonii, antigen I/II from S. mutans, etc.
197609	LysM	0.009	165	210	1	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT64847.1|CBM50	1.24e-230	1	298	1	298
QGI61174.1|CBM50	2.06e-229	1	298	1	298
QGI92072.1|CBM50	2.06e-229	1	298	1	298
QGI78351.1|CBM50	2.06e-229	1	298	1	298
QKD53575.1|CBM50	3.11e-139	1	298	1	288

PDB Hits     

FFUJ_03894-t31_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	6.51e-43	38	298	164	458	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4B4P8|LYSM2_ARTBC	2.51e-19	173	294	40	178	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4AZ68|LYSM3_ARTBC	1.78e-16	151	295	256	406	LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01488 PE=3 SV=1
sp|D4B5F9|PGDA_ARTBC	1.46e-08	155	212	380	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2
sp|D4AVW3|LYSM5_ARTBC	2.24e-07	153	213	476	537	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000197	0.999776	CS pos: 20-21. Pr: 0.9724

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_03894-t31_1-p1.