CAZyme Information: FFUJ_03618-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_03618-t31_1-p1
• CAZy Family: AA9
• CAZyme Description: related to beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
846		93869.97	5.0161

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679025:4830561-4833203(-)

Full Sequence      

MRSIDRDLSSELSLEDTVNLLSGHDFWNTRTNQALGLGSLKFSDGPNGVRGEDWINGAPS
TAIPCGTALGASFDVELATKLAGVLARECKRKGVHGLLAPTMNIHRYPLCGRNFESYSED
PLLSGLIAASFVKGLQAQGIATSPKHFLANEAENGRRWSDSVIEERALREIYLEPFRIVV
EQADPWCIMTAYNSVNGSFCSESQSLLSILRDEWRYNGAVISDWFGTYSTTDAFNAGLDL
EMPGPTKFREYKKVLEALKRGEIQNKQIKKSAARVVNLLRKTGRVGEPGFPPPLKAEEPD
YLEDLESRSLIRQAAESSMVLLKNEGDTLPLVDRDTRLAVFGHHAIEPSLFGGGSASLKV
PYASTPWEALQKTYRNATLGAGVAVNRLVPLPNESGLHIDSITLYWHNGDQPSPQQLFHS
QELKDTLYMLVEHAPDGLQDRSDFCTSMNFELVAQKTGPYNLSLSGPGSAKCLLDNRIVL
DVERDLNISTEDFLFDRSKLEVRRQEPVHLEAGRRYKFEVLSWSSKHKAQNVNREFFIQG
CRLGLALASDDDIALARAEKLAETVDTALVVVGTGTEWESEGFDRVSMKLPRRQDELILR
VAKACHGRTIVVVNVGSPIDTSSWIDEVDAVIYAWFPGMEFGNALARIISGDASPCARLP
TTFWDTVEDYPAGNVESLMTSEKEIHYREGIYVGYRQPSLETYSPRFAFGHGLSYSVFSC
SVKSPTNLTFDPIQAAVKVILEVQNTGAVAASETILLFIEASEPTTPRPRVELRTFAKTA
ILEPGASQDLEFCLTAQGFSYWDVQDHLWRVDAGNYRFRMAGPRGVGDWKEINDVVVRVD
EGFTIE

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	32	243	2.2e-61	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	4.92e-69	25	366	48	382	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.76e-47	530	695	53	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
185053	PRK15098	2.02e-42	61	805	118	736	beta-glucosidase BglX.
395747	Glyco_hydro_3	1.43e-35	61	278	86	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	2.29e-29	56	729	104	648	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT66579.1|GH3	0.0	1	846	1	846
QGI93649.1|GH3	0.0	1	846	1	861
QGI62759.1|GH3	0.0	1	846	1	861
QKD50590.1|GH3	0.0	1	846	1	846
CEF86475.1|GH3	0.0	1	845	1	847

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.50e-142	8	816	9	817	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.01e-138	8	816	9	817	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	7.16e-104	6	816	6	649	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	8.16e-92	7	821	6	699	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.14e-90	7	821	6	699	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DPG0|BGLH_NEOFI	1.56e-148	10	817	12	802	Probable beta-glucosidase H OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglH PE=3 SV=1
sp|A1DNN8|BGLJ_NEOFI	2.41e-146	2	822	12	842	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|A1CUR8|BGLH_ASPCL	2.59e-146	4	817	7	802	Probable beta-glucosidase H OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglH PE=3 SV=1
sp|B0XM94|BGLH_ASPFC	1.01e-145	10	817	12	802	Probable beta-glucosidase H OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglH PE=3 SV=1
sp|Q4WLY1|BGLJ_ASPFU	3.76e-145	2	822	12	843	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.952408	0.047606

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_03618-t31_1-p1.