CAZyme Information: FFUJ_03562-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_03562-t31_1-p1
• CAZy Family: AA9
• CAZyme Description: probable rhamnogalacturonase A precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
488		52758.22	5.9418

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679025:4704459-4706231(+)

Full Sequence      

MKSLLITGLFSALLATAQLTGPVGPLTALSQKTHECNILDYGAVDDNSTDIADAIEKTFK
TCVLPHAGSRLIVPDGQYLIKRSVVLSNGTNWAFQLDGLITLAYGGNWTVDRKLVLQGFA
GVELLNATINGEGDGQFLQNGLTIINPVDFEFYSQNGKGAIQGQGYIYRNLANTFRPRLV
RIISPINTSVHDLILVDSPKFHIVFDFAENLEVYHLTIRGANLGSYDGVDVVGTNYWIHD
IEVTNRDECVSVKSPSSHALIENLVCNQAGSGISIGSLNVSASIANIHARNINIIQGNNI
AFIKTYPGGSGHVTNITFENFRSKASLYGLDINQYWQNTFEPDTRAVALSNLVFKNFSGS
VADGSKRPPLFLVANDLSFATNVTVQDFSIWTESGTSVINKISNIFGHGDNSYGQANGIK
SLSSGQAPTAYTSTYTVTATPTGWTAPSFPTWAVASTGYGTDVPIPVYTPAALWKPSGDY
DKHYWGSF

Enzyme Prediction     

No EC number prediction in FFUJ_03562-t31_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	149	396	1.3e-47	0.7353846153846154

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	2.57e-19	159	404	61	317	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215426	PLN02793	9.74e-17	40	362	57	369	Probable polygalacturonase
177865	PLN02218	1.60e-16	37	362	69	383	polygalacturonase ADPG
215540	PLN03010	9.65e-16	37	412	48	396	polygalacturonase
227721	Pgu1	4.52e-15	37	320	84	392	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT66526.1|GH28	0.0	1	488	1	488
QGI79884.1|GH28	0.0	1	488	1	488
QGI93610.1|GH28	0.0	1	488	1	488
QGI62718.1|GH28	0.0	1	488	1	488
QKD50641.1|GH28	0.0	1	488	1	488

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	4.98e-97	18	466	1	404	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
1BHE_A	5.48e-08	82	386	40	368	Chain A, POLYGALACTURONASE [Pectobacterium carotovorum]
1CZF_A	2.87e-07	217	365	173	322	Endo-Polygalacturonase Ii From Aspergillus Niger [Aspergillus niger],1CZF_B Endo-Polygalacturonase Ii From Aspergillus Niger [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QYE5|RHGA_ASPNC	1.07e-98	13	476	14	431	Probable rhamnogalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgA PE=3 SV=1
sp|P87160|RHGA_ASPNG	3.01e-98	13	476	14	431	Rhamnogalacturonase A OS=Aspergillus niger OX=5061 GN=rhgA PE=1 SV=1
sp|Q5ARE6|RHGA_EMENI	1.40e-96	13	476	13	430	Rhamnogalacturonase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rhgA PE=2 SV=2
sp|Q00001|RHGA_ASPAC	1.57e-96	14	466	15	422	Rhamnogalacturonase A OS=Aspergillus aculeatus OX=5053 GN=rhgA PE=1 SV=1
sp|B8NKB9|RHGE_ASPFN	8.12e-96	1	476	1	437	Probable rhamnogalacturonase E OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rhgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000384	0.999605	CS pos: 17-18. Pr: 0.9700

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_03562-t31_1-p1.