CAZyme Information: FFUJ_02361-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_02361-t31_1-p1
• CAZy Family: AA7
• CAZyme Description: probable exopolygalacturonase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
464		51708.47	8.3349

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679025:693188-694778(+)

Full Sequence      

MKVSSFFSTLSLFAGVLAEAIDLPAGVPRSIEEFRAKHPYELPVKRSHRKVYTIRHSKND
HDDVSSEFYKGLKKANKGGTLYLPKGQTFVIGKPLDLTFLNDVHVHLEGEIKFTNDTEYW
QKNAYKHPFQNSIMFWKWGGKNIKLYGKGVLNGNGQRWWNEFAGKEILDTTNAYLRPILF
YAQNATNLDIQGVHFKDSPCWTNFVVTSKDISFKDVICTARSTNATALPKNTDFFDSLNV
ENLNVERAWVDIGDDCFSPKSNATNVHVDTMYCNGTHGQSIGSLGQYKGEMSFVKDVVIE
NVWMLNGQHGARLKTWAGPDIGYGFIDNVTFRNFWGGNNEYTAFIDSCYFNINATTCAQY
PSRMNITNVLFDNFTGYSSGKYGNAVARLTCSTSKDAVCENIKFKDFNIKTPCGGDPVFL
CDGVKDIGVDCVSATSAAGKAALANKCVAPQASVSPFKVRKFNG

Enzyme Prediction     

EC	3.2.1.67:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	74	425	1e-64	0.96

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	2.72e-37	80	425	8	316	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215426	PLN02793	1.78e-23	83	421	90	406	Probable polygalacturonase
177865	PLN02218	6.04e-23	63	428	82	424	polygalacturonase ADPG
178580	PLN03003	8.90e-23	63	415	38	363	Probable polygalacturonase At3g15720
215540	PLN03010	9.77e-21	80	437	82	408	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI78762.1|GH28	0.0	1	464	1	464
CCT65422.1|GH28	0.0	1	464	1	464
QGI61573.1|GH28	0.0	1	464	1	464
QGI92473.1|GH28	0.0	1	464	1	464
BAE97098.1|GH28	0.0	1	464	1	464

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	3.58e-54	62	436	30	387	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1HG8_A	1.60e-16	62	376	1	303	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]
1IA5_A	2.08e-15	92	376	35	293	Polygalacturonase From Aspergillus Aculeatus [Aspergillus aculeatus],1IB4_A Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus],1IB4_B Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus]
2IQ7_A	7.40e-13	74	424	13	331	Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_B Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_C Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_D Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_E Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_F Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_G Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini]
1RMG_A	4.87e-12	254	421	197	350	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DAX2|PGXB_NEOFI	2.13e-169	6	436	10	436	Probable exopolygalacturonase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pgxB PE=3 SV=1
sp|Q0C7H7|PGXB_ASPTN	4.99e-161	6	436	9	435	Probable exopolygalacturonase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pgxB PE=3 SV=1
sp|Q2TW03|PGXB_ASPOR	4.99e-161	49	431	49	430	Probable exopolygalacturonase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pgxB PE=3 SV=2
sp|B8NX60|PGXB_ASPFN	7.07e-161	49	431	49	430	Probable exopolygalacturonase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pgxB PE=3 SV=1
sp|Q873X6|PGXB_EMENI	8.40e-161	5	433	20	438	Probable exopolygalacturonase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pgxB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002433	0.997530	CS pos: 18-19. Pr: 0.9625

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_02361-t31_1-p1.