CAZyme Information: FFUJ_02255-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_02255-t31_1-p1
• CAZy Family: PL42
• CAZyme Description: related to agglutinin isolectin 1 precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352		35599.38	4.4515

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679025:417533-418864(+)

Full Sequence      

MELSLAYFLCILSLASASFPFNFGLSSSPVLLPRAKNPTSKDGNCGSNSETNATCLTSTF
GNCCSEKGFCGKTSAYCNEGCQSAFGSCSSSDDGQLVSTSGSCGATSTSNITCEGSSYGD
CCSEKGYCGKNATYCGAGCQSMFGSCSSSDESSTTTATSDKTSTSTSAASTSLGAISIDG
NCGSNSDTNATCQDSTFGDCCSAKGYCGKTSDYCASGCQSDFGSCDSSSSSASESASSAT
SSSESSSSTPSTTPSTAGLSTGAKAGIAVGSVIGGLGAIGLVAFLVLRRKNRKSSQQLTD
SDAGKPNDETRYELHDERTHEMHAQNLVELPADYGRVDDRAAAGYDGAYRGH

Enzyme Prediction     

EC	-	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
211316	ChtBD1_1	4.18e-09	186	226	4	44	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211316	ChtBD1_1	6.64e-08	49	88	4	43	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211316	ChtBD1_1	1.96e-06	107	144	4	41	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
395135	Chitin_bind_1	6.32e-05	181	220	1	36	Chitin recognition protein.
395135	Chitin_bind_1	1.15e-04	44	83	1	36	Chitin recognition protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI78660.1|CBM18	3.25e-175	1	352	1	352
QGI61474.1|CBM18	3.25e-175	1	352	1	352
CCT65321.1|CBM18	3.25e-175	1	352	1	352
QGI92372.1|CBM18	3.25e-175	1	352	1	352
QKD51953.1|CBM18	5.43e-155	1	352	1	352

PDB Hits     

FFUJ_02255-t31_1-p1 has no PDB hit.

Swiss-Prot Hits     

FFUJ_02255-t31_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000312	0.999678	CS pos: 17-18. Pr: 0.9650

TMHMM  Annotations     

Start	End
265	287