CAZyme Information: FFUJ_02205-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_02205-t31_1-p1
• CAZy Family: AA7
• CAZyme Description: related to galactinol synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314		35337.46	7.3227

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679025:297342-298347(-)

Full Sequence      

MVSENTATLPSKVWATLVTNDDYLKGVLTLNYRLRCVKSKYPLLVLYTSTLSQASVESLK
RRGVAALQVPRLAPTTAKEYTDDPRFNECWTKLIAFSLTDYSRIVLLDSDMLPLQSMDEL
MDLDLDFPLLSGSGDTERSKRVFAACHACTCNPLRKPHYPPNWKPENCALTTQHVSPDTA
QTTGADNSSGLGKLNSGLLVINPSKVIFDQIVTKLNEAGLDYQFPDQDLLADLFKGRWVA
LPYIYNALKTMRDPSVHGAIWRDDKVKNVHYILSPKPWDELGPDGTWKGDKPIHKWWIDA
YKSMRAEEKTLGIS

Enzyme Prediction     

No EC number prediction in FFUJ_02205-t31_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	5	281	7.4e-47	0.9105058365758755

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	3.44e-70	13	304	2	240	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
133037	GT8_A4GalT_like	1.91e-16	82	278	71	246	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
133064	GT8_GNT1	2.35e-13	18	278	7	238	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
227884	Gnt1	3.04e-13	16	297	75	331	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
279798	Glyco_transf_8	2.88e-10	16	282	3	252	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT65272.1|GT8	3.60e-238	1	314	1	314
QGI78615.1|GT8	4.20e-237	1	314	1	314
QGI92327.1|GT8	2.33e-234	1	314	1	314
QGI61429.1|GT8	2.33e-234	1	314	1	314
QKD52013.1|GT8	5.34e-215	1	314	1	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MW5_A	5.51e-17	14	297	10	253	UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Platinum [Globisporangium ultimum],6MW8_A UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Manganese [Globisporangium ultimum]
6EQJ_A	9.91e-09	8	279	1	222	Crystal Structure of Human Glycogenin-1 (GYG1) Tyr195pIPhe mutant, apo form [Homo sapiens],6EQL_A Crystal Structure of Human Glycogenin-1 (GYG1) Tyr195pIPhe mutant complexed with manganese and UDP [Homo sapiens],6EQL_B Crystal Structure of Human Glycogenin-1 (GYG1) Tyr195pIPhe mutant complexed with manganese and UDP [Homo sapiens]
3Q4S_A	1.33e-08	8	279	1	222	Crystal Structure of Human Glycogenin-1 (GYG1), apo form [Homo sapiens],3QVB_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP [Homo sapiens],3U2W_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and glucose or a glucal species [Homo sapiens],3U2W_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and glucose or a glucal species [Homo sapiens]
3USQ_A	1.61e-08	9	297	21	270	Structure of D159S/Y194F glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus]
3USR_A	1.61e-08	9	297	21	270	Structure of Y194F glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5UNW1|YR707_MIMIV	1.16e-18	20	305	13	269	Uncharacterized protein R707 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R707 PE=4 SV=1
sp|O22693|GOLS4_ARATH	6.25e-14	10	310	21	301	Galactinol synthase 4 OS=Arabidopsis thaliana OX=3702 GN=GOLS4 PE=2 SV=1
sp|Q947G8|GOLS1_SOLLC	8.53e-13	17	312	26	289	Galactinol synthase 1 OS=Solanum lycopersicum OX=4081 GN=GOLS1 PE=2 SV=1
sp|Q9XGN4|GOLS1_AJURE	1.29e-12	17	312	29	306	Galactinol synthase 1 OS=Ajuga reptans OX=38596 GN=GOLS1 PE=1 SV=1
sp|C7G304|GOLS2_SOLLC	1.79e-12	8	313	20	304	Galactinol synthase 2 OS=Solanum lycopersicum OX=4081 GN=GOLS2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_02205-t31_1-p1.