CAZyme Information: FFUJ_02196-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_02196-t31_1-p1
• CAZy Family: AA7
• CAZyme Description: uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391	HF679025|CGC1	43325.86	7.6423

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679025:282421-283596(+)

Full Sequence      

MKTFLAFASVTAFSCSFATAAPPSNYLNWKTFKANGVNLGGWLHQEAVIDPKWWNQYAPG
TPDEWDFCAKLKSQCGPVLEQRYASYITKKDIDTMAAAGINVMRVPTGYNAWVTVPGSQL
YNGNQARFLRAISDYAIKKYGIHVILDIHSLPGGLNGMGLGEKEGNYGWFQNQTALEYSY
KAVDAAIEFIQGSDVPQGFTLAPINEPVDNRDITKFGTPEALSDQGAAWVLRYFQGVISR
VEKVNPKIPTMLQGGFRPVDYWAKYFAASTNLVFDVHNYYFAGRPTTSQNLAEFICSDAK
KIVSTASPKFPVFVGEWSIQAATNNTLASRARNLNTGLKAWAAYTQGSAYWTWKFFGNEP
VDGEGTQGDYWNYSNFVKMDIIDPSSGATCK

Enzyme Prediction     

EC	3.2.1.149:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	83	364	6.1e-142	0.9964285714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	2.16e-17	22	389	6	394	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	4.22e-09	83	357	20	272	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT65263.1|GH5_23	7.17e-302	1	391	1	391
QGI78607.1|GH5_23	4.77e-295	1	389	1	389
QGI61425.1|GH5_23	4.77e-295	1	389	1	389
QGI92323.1|GH5_23	4.77e-295	1	389	1	389
QKD62241.1|GH5_23	5.90e-276	1	391	1	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LA0_A	2.62e-152	26	383	11	365	Chain A, Glycoside hydrolase family 5 [Aspergillus oryzae],6LA0_B Chain B, Glycoside hydrolase family 5 [Aspergillus oryzae]
6I1A_A	7.78e-151	20	377	7	364	Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger],6I1A_B Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger]
1EQP_A	6.37e-15	36	344	11	311	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PF0_A	1.58e-14	36	344	17	317	Chain A, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	2.06e-14	36	344	11	311	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAR6|EXGA_ASPNC	1.10e-31	24	318	32	310	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|Q9URU6|EXG1_SCHPO	6.24e-26	11	318	19	314	Glucan 1,3-beta-glucosidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg1 PE=2 SV=1
sp|A1CRV0|EXGA_ASPCL	9.39e-26	27	318	35	309	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
sp|B0XN12|EXGA_ASPFC	6.21e-25	36	336	44	327	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|Q4WK60|EXGA_ASPFU	8.49e-25	36	336	44	327	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000243	0.999736	CS pos: 20-21. Pr: 0.9771

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_02196-t31_1-p1.