CAZyme Information: FFUJ_02141-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_02141-t31_1-p1
• CAZy Family: AA7
• CAZyme Description: related to putative alpha-L-fucosidase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607		67731.72	5.6137

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679025:159228-161322(-)

Full Sequence      

MLIRLLSHLGPVLSLGTASVGAVSLKHSKRATSPASIGIGNPVLTSKWIEGSDYEQVVEF
FITNSDDKNSLTWDDDLEVSVESSSLETTTPGTLIRLGPKQSAVVQVGVKNKAGVKAGTK
CDAKAVVTWGSKEDPKKSTKDFSGECGIGDYQASSGSLSHHWNPDWFNDIKYGIFIHWGL
YSVPAFGNKPGPKQDYAEWYGFRMTQPDFPSETYQYHREKYGENFNYDDFVSNFTAAKFD
ANEWMNLVADAGAQYVVPVTKHHDGWALFDFPDSVSKRSTVHYGPKRDFLKELLDAAKVN
HPKIRRGTYFSMPEWFNPAYVKYGWDQHYKGNYYGRPPTNPYTHKSIEYTGYVEVDDFLD
DIQNPQIEALFYKYETEILWCDIGGPNKAPDVLAPWLNWARDKGRQVTFNDRCGAAGDYS
TPEYAGISFKASKFESNRGLDPFSFGYNFMTTDDEYLTGEEIVNTLIDNVVNNGNLLLNM
GPKPDGTIPKQQQLNLLDAGAWIKSHGEGIFGTRYWPTAQTSGPLRFATAPDAFYIHHVG
KPSSPLVIKEPVPWVEGDKVTAIGGSADGTVLDVAQKDGSFVVQLPDKVIQGDKYIWTIK
IEYKTGN

Enzyme Prediction     

EC	3.2.1.51:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	149	512	4.8e-82	0.9248554913294798

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214829	Alpha_L_fucos	1.61e-89	149	551	5	384	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
395889	Alpha_L_fucos	1.80e-86	149	508	4	333	Alpha-L-fucosidase.
226195	AfuC	1.83e-44	177	516	1	325	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
405546	GHL6	0.002	240	355	1	114	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI61378.1|GH29	0.0	1	607	1	607
CCT65213.1|GH29	0.0	1	607	1	607
QGI78559.1|GH29	0.0	1	607	1	607
QGI92276.1|GH29	0.0	1	607	1	607
APG32842.1|GH29	0.0	1	607	1	607

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ODU_A	4.52e-65	151	550	8	399	Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8],1ODU_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8]
2ZWY_A	5.25e-65	151	550	8	399	alpha-L-fucosidase [Thermotoga maritima],2ZWY_B alpha-L-fucosidase [Thermotoga maritima],2ZWZ_A alpha-L-fucosidase complexed with inhibitor, Core1 [Thermotoga maritima],2ZWZ_B alpha-L-fucosidase complexed with inhibitor, Core1 [Thermotoga maritima],2ZX5_A alpha-L-fucosidase complexed with inhibitor, F10 [Thermotoga maritima],2ZX5_B alpha-L-fucosidase complexed with inhibitor, F10 [Thermotoga maritima],2ZX6_A alpha-L-fucosidase complexed with inhibitor, F10-1C [Thermotoga maritima],2ZX6_B alpha-L-fucosidase complexed with inhibitor, F10-1C [Thermotoga maritima],2ZX7_A alpha-L-fucosidase complexed with inhibitor, F10-2C [Thermotoga maritima],2ZX7_B alpha-L-fucosidase complexed with inhibitor, F10-2C [Thermotoga maritima],2ZX8_A alpha-L-fucosidase complexed with inhibitor, F10-2C-O [Thermotoga maritima],2ZX8_B alpha-L-fucosidase complexed with inhibitor, F10-2C-O [Thermotoga maritima],2ZX9_A alpha-L-fucosidase complexed with inhibitor, B4 [Thermotoga maritima],2ZX9_B alpha-L-fucosidase complexed with inhibitor, B4 [Thermotoga maritima],2ZXA_A alpha-L-fucosidase complexed with inhibitor, FNJ-acetyl [Thermotoga maritima],2ZXA_B alpha-L-fucosidase complexed with inhibitor, FNJ-acetyl [Thermotoga maritima],2ZXB_A alpha-L-fucosidase complexed with inhibitor, ph-6FNJ [Thermotoga maritima],2ZXB_B alpha-L-fucosidase complexed with inhibitor, ph-6FNJ [Thermotoga maritima],2ZXD_A alpha-L-fucosidase complexed with inhibitor, iso-6FNJ [Thermotoga maritima],2ZXD_B alpha-L-fucosidase complexed with inhibitor, iso-6FNJ [Thermotoga maritima]
1HL8_A	8.80e-65	151	550	8	399	Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL8_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL9_A Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8],1HL9_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8]
2WSP_A	4.65e-64	151	550	8	399	Thermotoga maritima alpha-L-fucosynthase, TmD224G, in complex with alpha-L-Fuc-(1-2)-beta-L-Fuc-N3 [Thermotoga maritima MSB8],2WSP_B Thermotoga maritima alpha-L-fucosynthase, TmD224G, in complex with alpha-L-Fuc-(1-2)-beta-L-Fuc-N3 [Thermotoga maritima MSB8]
7LJJ_A	8.82e-52	151	602	43	511	Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LK7_A Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q99KR8|FUCO2_MOUSE	4.87e-54	151	554	28	396	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1
sp|P10901|FUCO_DICDI	2.50e-53	164	529	34	379	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
sp|Q6AYS4|FUCO2_RAT	6.28e-52	151	554	26	394	Plasma alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca2 PE=2 SV=1
sp|Q5RFI5|FUCO2_PONAB	6.99e-51	157	554	38	400	Plasma alpha-L-fucosidase OS=Pongo abelii OX=9601 GN=FUCA2 PE=2 SV=1
sp|Q9BTY2|FUCO2_HUMAN	1.01e-50	157	554	40	402	Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.970403	0.029609

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_02141-t31_1-p1.