CAZyme Information: FFUJ_01550-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_01550-t31_1-p1
• CAZy Family: AA4
• CAZyme Description: related to endo alpha-1,4 polygalactosaminidase precusor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335	HF679023|CGC14	37135.91	4.7901

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679023:1728802-1729868(+)

Full Sequence      

MVTFHQIALTVLAVGGSVSARRKDECRVASHVKAVEAKPAAAASSALFELSDFKPGVEWE
IVLHQPIKHDTVADLIPSKAKVWDIDMGHGRDYPEMIPLLKGAGKFVICYFNAGALQSWD
KDIKQFPKAVIGHSLAYPYDSEEWYLDIRDSTVLKLQKARLDVAAKIGCDAVDPDNVDAW
QQDGEDPTGFKLKPSDYTKYLKNLAEYAHSIKTKDGNRLLVGQKNAPEVAEDLVSTLDFA
VLESCRGTTDPDEENWPFCEDFQTYIDAGKPVLQIEYPPSVEKTGKLSSSDNAYYCTPKG
EDKGFSKILKWASAQLDGWGQFCGEDPFHTPVINE

Enzyme Prediction     

No EC number prediction in FFUJ_01550-t31_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH114	59	277	5.8e-50	0.9947368421052631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397552	Glyco_hydro_114	3.45e-68	59	310	2	215	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
226386	COG3868	2.86e-11	100	281	98	270	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
225219	COG2342	2.63e-06	94	277	63	251	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI89288.1|GH114	1.90e-255	1	335	1	335
QGI58377.1|GH114	1.90e-255	1	335	1	335
CCT61950.1|GH114	1.90e-255	1	335	1	335
QGI75595.1|GH114	1.90e-255	1	335	1	335
QKD47958.1|GH114	1.33e-233	1	335	1	319

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6OJ1_A	5.31e-30	56	323	39	277	Crystal Structure of Aspergillus fumigatus Ega3 [Aspergillus fumigatus Af293]
6OJB_A	7.58e-30	56	323	56	294	Crystal Structure of Aspergillus fumigatus Ega3 complex with galactosamine [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

FFUJ_01550-t31_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.212867	0.787090	CS pos: 20-21. Pr: 0.7576

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_01550-t31_1-p1.