CAZyme Information: FFUJ_00422-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_00422-t31_1-p1
• CAZy Family: AA2
• CAZyme Description: related to beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
855		98444.60	5.4975

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679023:5434568-5437183(-)

Full Sequence      

MAPRTVTPIDKNWQFKQGKEDDSSYLPVAQFPTNVHLDLLHHKKIPDPYIGKNELKVQWV
GETVWVYKTTFSSPEIHDGAKAVLAFDGLDTFAKVELNGEEILETENMFVPERVAVTKNL
KKDGENELRITFDAAYLRGWKLVEEHPDHKYVVWNGDGSRLPVRKAQYHWGWDWGPALLT
CGPWRPINLEVYESHIADLYTESEVEKSLKKADVVVQAAVEGKASRVRFEVSLDGKKIAS
ETAHVKDKDATTTFHIQDPALWYPVRYGKQPLYTIKAILLEDDNEIDTISKKIGIRKLEL
VERELDGQPGTSFFFQVNNIPIFCGGSNWIPADNFIPRIAKEKYRDWVKLVADGNQFMLR
VWGGGIYEEDVFYDACDEFGILVWQDFMFACGNYPAWPDLLKSVDREARANIKRLRHHPS
IVLWAGNNEDYQLRESENLTYDFDDHDPESWLKTDFPARYIYEKLLPDACKDLHPNAVYH
IASPWGGKVTTDPTIGDIHQWNVWHGSQQKYQDYDKLVGRFVSEFGMEGFPDIRTIDAFL
PQGKDDPERFSTSSTIDFHNKADGQLRRLGLYMAENFRFTLEPLEDYVYYSQLLQAEALA
SAYRLWKRQWQGPKKEYCSGVLVWQTNDCWPVTSWAICDYYLRPKHSYFTIKREMAPITI
GMTRREHKHPRNKYTRVDIETKVKVEIWGSNLKLEDVTVDCVVKAWDVETGKETYSQTVV
SDLVLQSNCSTEIKILDVPVEKPNADLEAKTVVAAYFYQDGKQIARYVNWPEPLKYLHFQ
KPKNLKSELSEGCKYVEISAEVPIKGLAVLSEDDEVKFEDNLVDVVPGEIVKIGITGAKK
GTVLKTQYLGMQVHD

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	4	742	1.3e-93	0.7021276595744681

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	2.09e-83	1	652	7	627	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	4.59e-15	684	776	2	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
395572	Glyco_hydro_2	5.24e-14	195	296	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236657	PRK10150	7.68e-14	13	429	19	417	beta-D-glucuronidase; Provisional
236673	ebgA	1.42e-11	66	431	112	452	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT62972.1|GH2	0.0	1	855	1	855
QGI90362.1|GH2	0.0	1	855	1	855
QGI59453.1|GH2	0.0	1	855	1	855
QGI76661.1|GH2	0.0	1	855	1	855
QKD46795.1|GH2	0.0	1	855	1	855

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.10e-146	1	668	21	666	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	6.10e-118	6	841	8	824	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	6.39e-118	6	841	10	826	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	6.55e-118	6	841	10	826	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	1.71e-117	6	841	8	824	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I2C092|MANBB_THETO	0.0	1	851	1	854	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
sp|Q0CCA0|MANBB_ASPTN	1.93e-286	1	850	1	842	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
sp|Q5B7W2|MANBB_EMENI	1.89e-281	1	850	1	842	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
sp|A1D911|MANBB_NEOFI	1.15e-280	8	850	8	844	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
sp|Q4WAH4|MANBB_ASPFU	6.06e-278	8	850	8	844	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_00422-t31_1-p1.