CAZyme Information: FFUJ_00101-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_00101-t31_1-p1
• CAZy Family: AA1
• CAZyme Description: probable sterol glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
802	HF679023|CGC24	86268.16	7.1180

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679023:6309009-6311806(-)

Full Sequence      

MSPTPDDNQSHRQTRYFELPANGEHSAQLPDELPPYQALAELEATTTGREDGRIDIDLSS
RIARRLSKLVPTGKPPISYGQNQPPAYTETSEKSIRLNIVIQVVGSRGDVQPFVALGTEL
QRHGHRVRLATHGQFDKFVRESGLEFFSIGGDPAELMAYMVKNPGLFPSMKTLRGGEIQR
KRKMVDEMLHKCWSSCIEPDELTGRPFVADAIIANPPSFAHIHCAQALGIPLHLMFTMPW
TSTREFCHPLANLKANGSDMSATAANYVSYSLVECMTWQGLGDIINAWRDTIDLEAIPFS
EGPCLTETLGVPVTYCWSPALVPKPADWPENIDVCGFFFRDAPKYQPEPALQQFLASGPP
PIYIGFGSIVIDDPDKLTATILDAVRATGTRAIVSRGWSKLGGDSPGDDQVFFLGDCPHE
WLFQHVTAVIHHGGAGTTACGLLNAKPTTIVPFFGDQPFWGNMVHAGGAGPAPIPFKALN
SSNLAEAILFCLTPEASAAARQIADKMSSAEMLVENEKVSWNNLKAYQPQPVHIENRRWD
PVTATLATLATTSVGMVTSASDIVVKPIQALRPVTPSGSRSASRDRSGNNSKRPSEEDVF
GRPAGIDMSSAPTATKDKDPNHGALAAVKGSASGVGGFFKHYSKGMLLDLPYAVTEGMRN
APKLYGGKAYDPGAVTDWKSGGIAAGKNFAHGMVEGIGGIIMEPVRGAKKEGAAGAAKGV
GIGLLNLGTKVGSGALGLFALPSQGAYMSARALVKRKTGKSIMEARKIEGRDVVERSEDA
AREKDRTAVIEGFETLAREKTR

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	122	510	2.1e-50	0.93717277486911

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.58e-78	97	510	1	391	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	9.34e-42	99	512	4	386	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	6.73e-24	99	246	1	138	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	7.49e-05	357	510	223	376	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
278624	UDPGT	0.006	362	488	278	402	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT63268.1|GT1	0.0	1	802	1	802
QGI59725.1|GT1	0.0	1	802	1	855
QGI76927.1|GT1	0.0	1	802	1	855
QGI90640.1|GT1	0.0	1	802	1	855
QKD46522.1|GT1	0.0	1	799	1	849

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GL5_A	1.35e-70	67	493	12	427	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
5XVM_A	1.12e-69	82	493	5	407	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
1IIR_A	1.56e-31	97	504	1	379	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	2.46e-27	97	504	1	362	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	9.71e-20	97	504	1	380	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	1.10e-122	49	511	111	561	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	6.73e-120	97	511	193	597	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|P0CN91|ATG26_CRYNB	8.11e-72	42	511	973	1449	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=ATG26 PE=3 SV=1
sp|P0CN90|ATG26_CRYNJ	8.11e-72	42	511	973	1449	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=ATG26 PE=3 SV=1
sp|A1CYS1|ATG26_NEOFI	2.24e-71	97	488	911	1291	Sterol 3-beta-glucosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=atg26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000002

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_00101-t31_1-p1.