CAZyme Information: EXJ76703.1

Basic Information

• Species: Cladophialophora psammophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora psammophila
• CAZyme ID: EXJ76703.1
• CAZy Family: GT8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422		42437.24	7.4100

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CpsammophilaCBS110553	13421	1182543	0	13421

• Gene Location: location=AMGX01000001:3434534-3435853(-)

Full Sequence      

MVVFSKSAALAALAFLAAAGDAHMIMKTPVPYGKSTLNNSPLVADGSDFPCKQRSGVYDA
EGASNVAAIGVPQTLSFIGSATHGGGSCQVSLTTDLQPSKNSKWMVIKSIEGGCPASAPG
NIGDDPNGSGASTFQFTVPEGITPGEYTMAWTWFNKVGNREMYMNCAPFTVTAAKKKRYM
PAPKASKRQTSFPDMFVANLAAINTCTTPESFDYVFPNPGADVQSAGSGPYTTLSCGSNG
NNTPQQPTGSIPAASGTATAAPTSYAAGPPSSAPAFASGNAGQYTASPPASAVPGNFASG
ASSVPTSSVVPSSTVTDLPQVVPTTIPAGAAYSTAPSNTAAATAPTTTPTGGSSAASNSS
AAGALTGPCPNEGFWNCINGNSFQRCASGSWSAVIPMNGMKCSPGISSDFSMTAANAKRW
EA

Enzyme Prediction     

EC	1.14.99.53:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA11	23	227	1.1e-71	0.9738219895287958

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
237865	PRK14951	0.001	247	337	366	452	DNA polymerase III subunits gamma and tau; Provisional
235906	PRK07003	0.002	225	337	363	466	DNA polymerase III subunit gamma/tau.
236090	PRK07764	0.002	247	337	390	480	DNA polymerase III subunits gamma and tau; Validated
236776	PRK10856	0.002	221	322	147	255	cytoskeleton protein RodZ.
215130	PLN02217	0.004	222	338	547	652	probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW31531.1|AA11	1.09e-94	3	418	1	403
QMW43588.1|AA11	1.09e-94	3	418	1	403
BAE61530.1|AA11|1.14.99.53	1.09e-94	3	418	1	403
QRD90522.1|AA11	1.09e-94	3	418	1	403
UDD60467.1|AA11	1.51e-93	3	418	1	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAH_A	2.85e-87	23	227	1	203	Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Zn [Aspergillus oryzae],4MAI_A Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Cu(I) [Aspergillus oryzae]

Swiss-Prot Hits     

EXJ76703.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001208	0.998767	CS pos: 22-23. Pr: 0.7198

TMHMM  Annotations     

There is no transmembrane helices in EXJ76703.1.