CAZyme Information: EXJ75974.1

Basic Information

• Species: Cladophialophora psammophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora psammophila
• CAZyme ID: EXJ75974.1
• CAZy Family: GT48
• CAZyme Description: phosphatidylinositol glycan, class M

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485	AMGX01000001|CGC20	53955.96	10.1211

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CpsammophilaCBS110553	13421	1182543	0	13421

• Gene Location: location=AMGX01000001:1356295-1357752(+)

Full Sequence      

MASPHKSFLSSRTFVFISAFLLRAALLVYGIHQDSVSALKYTDIDYYVFTDAARAVSRHS
SPYDRATYRYTPLLAWILLPTSWGGLWFHFGKALFALSDLIAGWLILRLLKRQRLEEQRA
LKYAAVWLLNPMVANISTRGSSEGLLCVLVMALLWAFETKKIVLSGLLLGLCVHFKIYPF
IYGASMLWALETPSSNPSAATKLQVALQFINRSRILLLLTSISTFTALNLLMYNTYGFPF
LQHTFFHHLTRIDHRHNFSPYNTLLYLSSAQAANPTYANLRSSISFESLAFIPQLLLSTI
LIPIGLAKRDLPTTMLAQTLAFVTFNKVCTSQYFLWYLIFLPLHLPNSSLLARPPLGVTA
LVLWVLGQAVWLQQGYRLEFLGKSTFVPGLFAASLAFFAINCWILGIVVGDVVDTSMDSK
MATSVEGGDRIASSSTTASEGGSTASVSELKARPVRDKRRGNSSIDTSSIANVHLGPRDR
VLKSN

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	136	408	4.6e-94	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	1.06e-86	9	409	6	415	GPI mannosyltransferase
252941	Mannosyl_trans	5.97e-74	136	409	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
399599	PIG-U	3.43e-07	60	250	48	243	GPI transamidase subunit PIG-U. Many eukaryotic proteins are anchored to the cell surface via glycosylphosphatidylinositol (GPI), which is posttranslationally attached to the carboxyl-terminus by GPI transamidase. The mammalian GPI transamidase is a complex of at least four subunits, GPI8, GAA1, PIG-S, and PIG-T. PIG-U is thought to represent a fifth subunit in this complex and may be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS05340.1|GT50	8.42e-172	1	412	5	419
BCS16894.1|GT50	8.42e-172	1	412	5	419
QSS62928.1|GT50	6.38e-171	7	419	3	421
QSS50664.1|GT50	9.05e-171	7	419	3	421
QSS74503.1|GT50	1.28e-170	7	419	3	421

PDB Hits     

EXJ75974.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2TXB8|GPI14_ASPOR	3.02e-170	15	412	11	410	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q5B7W0|GPI14_EMENI	3.01e-162	22	419	18	435	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q4WAH2|GPI14_ASPFU	1.99e-158	7	412	3	421	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	1.64e-157	15	411	29	484	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	2.20e-154	15	426	13	422	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.810241	0.189764

TMHMM  Annotations     

Start	End
13	32
85	107
162	184
215	237
284	306
321	343
350	372
387	409