CAZyme Information: EXJ75867.1

Basic Information

• Species: Cladophialophora psammophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora psammophila
• CAZyme ID: EXJ75867.1
• CAZy Family: GT4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
900		102279.10	5.4678

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CpsammophilaCBS110553	13421	1182543	0	13421

• Gene Location: location=AMGX01000001:1070973-1073725(+)

Full Sequence      

MAAKQRHALAARWKWRLADANGISKTDSILDPKTWTPVTAFPSVVQMELLAKNIIPDPNL
GENERQIQWVGGMDWEYSCSFPTPNGLGNSGIADLVFEGLDTFATVSLNGREILKSDNMF
IPYRVDVTSHLNPEGQENELLILFESALKKGDELEAKFGPRKQVIRDKRRNHIRKAQYHW
GWDWGPVIVTAGPYMPIYLETYTARLDDVYITTELAGDHSTATLTIGVQAAGPPARVAKV
SILDQALSQVSQEFDIALDNSKKGSARVTIVEPKLWWPNGQGPQHLYNVSVSLLDESSGQ
LDASTIRYGIRTIKVIQRPLDNAPGKTFLFNVNGRDIFCQGGNWIPGDNLLPTMTRERYF
DWIRLSKYHHLNMIRVWGGGIYETEDFFDACDEMGMLVWHDYAFACGDYPVHKEFLDSVK
AEAEAQTIRMRNRASLALLCGNNEDFGIQDFFGEPYDFKDHKGPFENSTFPARKIYLDLL
PKVCENLCPTVQYWPSSPWGEEGVNASDTTFGDLHQWAVWHGPQHSYQKYGELSGRFVSE
FGMHGFPIMRTVDVFAPDPKDRHPQSRTIDCHNKGHGAETRIARYLSENFRYDMKLENFA
YCSQLLQSEAYGYALRDWKRKFGGKGKEECAGAIIWQLNDVYPVTSWAYIDYYLRPKPAF
YTIRRNFAPISVGIERTPRSRWIDEDKPKDSYIPNFALFAHNTTSDEVKCTLEMRAYDLH
SGKAVDLNWAGVSSEVTLSAGYNTELGSLEPHSSWTEESLIILDASLIDPSSKKVLARFT
DWPEPYRYLQWPTDTRVTVSVQSVKNDRTNTNFNDTHFENLVTVTTNQPLKGCWLEPVYD
GSEKEDEPEPLWDDNMFDILPGQEVKVGVNGLRGRNVNVRFLADWEVGQQLPATTAKAHL

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	723	5.4e-90	0.6648936170212766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	5.65e-75	5	683	11	643	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	2.00e-13	95	331	86	288	beta-D-glucuronidase; Provisional
395572	Glyco_hydro_2	1.04e-09	204	311	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236673	ebgA	1.47e-08	206	398	211	394	cryptic beta-D-galactosidase subunit alpha; Reviewed
407658	Mannosidase_ig	1.27e-05	695	788	2	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT00148.1|GH2	0.0	13	887	11	880
QRV91212.1|GH2	6.12e-223	35	884	87	924
ATZ49691.1|GH2	5.41e-220	37	882	50	876
CCD56258.2|GH2	2.07e-219	37	882	27	853
QRW05283.1|GH2	7.05e-218	35	884	37	888

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.25e-127	42	675	49	661	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	1.14e-111	35	873	25	820	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.19e-111	35	873	27	822	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.22e-111	35	873	27	822	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	3.16e-111	35	873	25	820	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I2C092|MANBB_THETO	2.02e-216	9	882	9	852	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
sp|Q4WAH4|MANBB_ASPFU	2.55e-199	1	881	1	840	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
sp|A1CGA8|MANBB_ASPCL	3.60e-199	1	881	1	840	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
sp|B0YBU9|MANBB_ASPFC	5.08e-199	1	881	1	840	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
sp|Q0CCA0|MANBB_ASPTN	7.53e-198	1	873	1	830	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000085	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EXJ75867.1.