CAZyme Information: EXJ75713.1

Basic Information

• Species: Cladophialophora psammophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora psammophila
• CAZyme ID: EXJ75713.1
• CAZy Family: GT39
• CAZyme Description: trehalose 6-phosphate synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
936		105382.80	6.6736

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CpsammophilaCBS110553	13421	1182543	0	13421

• Gene Location: location=AMGX01000001:626004-628868(-)

Full Sequence      

MTIFVATLFLPYTINFDVPASGSRPESPELLRPQLTLAQNTPNETQTVSLFTPGAGSSSH
LSQSPGPIPPTPGATTDHEKIFRPHTERKISLTLPELKQEASLPVRAISRHDLHSPGWGK
TFTWNQPPSRAKSPPPSSILKHAVVMAKDVKEVKERAVSLGHNTAHRLGRRQRTRTVSHE
RHFSHDSYTVEKAIIGNGGLYNAIDAAGDAGICEEKTWVGTLGCPVDALDDHLKENIAEK
LENDYDCLTVYASDSDLNGHYEHYCKTILWPVVHYQIPDHPKSKAYEDHSWVFYVKVNEA
FADRIVKNWKKGDVIWIHDYHLLLLPGLLRQKLPEAQIGFFLHTAFPSSEIFRCLAVRTD
LLQGMLGANMIGFQNDEYGHHFLQTCSRLLNVEATKHGVILEDGRFVHVNTCPIGIDPKG
IDLQRQAKEVKEWVHTITDKYRGKRIIVARDKLDSIRGVRQKILAYELFLNKYPEYRDQV
VLIQIATSSAEDPELSATVADIVTRVNSTHSTLAHQPLVFLKQDIDFSQYMALLTVAECL
MITSLREGMNLTSHEWILCQDGKISQNKYGPLILSEFTGSATVFGHNALLVNPWHYSHCA
DAIKQALDMSLEERENRWKALYDIVVHQNAVGWFEHYIKGLEHAWKEHTVRDSTAVPRLS
LPSVKSKYQKAKKRLIILDYEGTLASWGSPTDIILTTPKRSVDVLNDLIEDKKNIVYVMS
SRMPEEMERLFSPVSGIGMIAENGAFVLEPSTDEWQELTNLEHVRDWKKGIKSILQYYVE
RIEGSRVEERHASLIFDYSEAEDRQGAFKQAGECANHINDACRGQNVNAIPIEDGLNISE
MDVHKGSAAQMIGENLEKASREKGVPFPDFLMVIGDSREDEYVFNWAHRLEKAGKIQDVV
TVTLGARSTEASATLTQGVTGVLSILEKLARTLQRV

Enzyme Prediction     

EC	2.4.1.15:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	166	642	1.1e-156	0.9831578947368421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	196	642	26	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	1.57e-180	178	642	14	469	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
223457	OtsA	3.36e-153	218	647	64	484	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
184712	PRK14501	5.08e-152	198	931	28	725	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
215555	PLN03063	1.83e-125	169	884	8	719	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS07788.1|GT20	0.0	1	932	1	922
BCR95224.1|GT20	0.0	1	932	1	922
QMW41842.1|GT20	0.0	1	930	1	922
QRD86165.1|GT20	0.0	1	930	1	922
BAE60220.1|GT20	0.0	1	930	1	922

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JBI_A	3.93e-95	237	641	61	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5DXF_A	1.47e-94	259	638	146	520	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5HUT_A	8.68e-92	195	652	29	478	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	8.68e-92	195	652	29	478	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HVO_A	6.93e-87	195	641	36	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14081|TPSX_SCHPO	2.53e-199	127	928	139	940	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E11.16c PE=1 SV=1
sp|Q9UUI7|TPSY_SCHPO	2.38e-184	4	929	5	889	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 100 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22F8.05 PE=1 SV=1
sp|P38427|TSL1_YEAST	2.22e-157	183	860	341	994	Trehalose synthase complex regulatory subunit TSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TSL1 PE=1 SV=1
sp|P38426|TPS3_YEAST	6.13e-156	183	834	309	934	Trehalose synthase complex regulatory subunit TPS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS3 PE=1 SV=3
sp|Q54NU9|TPSB_DICDI	1.32e-119	214	884	94	747	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.876675	0.123332

TMHMM  Annotations     

There is no transmembrane helices in EXJ75713.1.