CAZyme Information: EXJ75308.1

Basic Information

• Species: Cladophialophora psammophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora psammophila
• CAZyme ID: EXJ75308.1
• CAZy Family: GT90
• CAZyme Description: glycosyl hydrolase family 17

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
289		31249.33	3.9287

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CpsammophilaCBS110553	13421	1182543	0	13421

• Gene Location: location=AMGX01000002:1816665-1817534(+)

Full Sequence      

MKTSQLFTLATAAISGAEAYYKGFNIGANLANGACRSESDWEFVFNKVASFPGNFKSARL
YASSDCNTLANAVPAAIKTGTALLVGVWTEDNNHYEAEKQALLEAIQQYGHDWILAVSVG
SEDLYRGDTDANTLASQINDVRGMLWGLGASSKSVGHVDTWTAWVDPANTAVIEAVDWLG
NDAYPYWQGVQIDNGAANDAYWAAVNQVRAVAGGRDVWTTETGWPISGDAVGNSVPSVEN
LQTYWWQVSCASFDSLNYFFYDVDDFAASPSFAVVDSNYDPLIDMTCGS

Enzyme Prediction     

No EC number prediction in EXJ75308.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	4.21e-45	22	274	46	294	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.06e-20	23	251	2	266	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA06410.1|GH17	6.49e-107	1	287	1	295
QIW94742.1|GH17	2.39e-105	19	286	18	286
CCD34315.1|GH17	4.78e-104	1	287	1	294
ATZ46547.1|GH17	4.78e-104	1	287	1	294
QSZ35382.1|GH17	1.41e-103	1	287	1	295

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.17e-24	16	250	33	252	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	8.34e-24	16	250	33	252	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UUZ1|EGLC_ASPOR	3.35e-62	1	289	1	312	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|Q4WG16|EGLC_ASPFU	3.45e-61	1	289	1	312	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	3.79e-61	1	289	1	312	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	1.48e-60	1	289	1	312	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|Q0C7P6|EGLC_ASPTN	3.61e-59	1	287	1	311	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.224009	0.775976	CS pos: 19-20. Pr: 0.6542

TMHMM  Annotations     

There is no transmembrane helices in EXJ75308.1.