CAZyme Information: EXJ71997.1

Basic Information

• Species: Cladophialophora psammophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora psammophila
• CAZyme ID: EXJ71997.1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
585	AMGX01000006|CGC6	64891.41	5.8030

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CpsammophilaCBS110553	13421	1182543	0	13421

• Gene Location: location=AMGX01000006:448748-450630(-)

Full Sequence      

MVHPATAPKGAPQAFDFIVVGGGTAGCVVAGRLAENPKVSVLVIEAGINNTNEIPEISTP
ARAFELRGSQYDWGYKTTMINRPDYTRVEKPNTRGKMLGGSSGGNYYTWVRGSAATFDDW
AEYGTDEWNWENTEEYFNKSTTFHDDNKLYPADLAKIGNRGGPLHISHSDLIPELQPFRD
ALEKAWVSKGQELTTDVYSGVQKGLFRCVNSIYKGKRSTAAVFIEGKENVTLMSSTISKK
IVFEGNKAVGVTVIGPDGQDYTFRAKYEVIVSQGVFETPKLLMLSGIGPKEHLESKGIKT
LVDSEHVGQNLLDHPILSHVFKIKDGYGLDSHLLRAGPQKDGAIAAYRKNRTGPYSSGLL
ELVAFPRADEWFETSKEYREYKAKNGGVDPFGPAGQPHFEVDFVPMFCDAFQWHFPTPPE
GDYLTAIVDLMRPLSRNGEVKLNSTDPTEQPYVNINFFSHDLDLIALREGVRMIDDIVMN
GEGIKDLIEGDYPWPMPRNSDEAMIRQILERSQTGFHPCGTARLGKDIKQGVVNPKLQVY
GASNLRVIDASVFPVIPDCRIQNDVYMVAEKGADLIKADYPSLFK

Enzyme Prediction     

No EC number prediction in EXJ71997.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	14	579	5.6e-155	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.19e-102	13	577	4	532	choline dehydrogenase; Validated
225186	BetA	2.82e-93	15	581	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.32e-41	433	571	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.76e-28	4	568	45	568	Protein HOTHEAD
366272	GMC_oxred_N	2.53e-26	94	316	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB80031.1|AA3_2	0.0	1	585	1	585
AUB24176.1|AA3_2	0.0	1	585	1	585
AFR94515.1|AA3_2	0.0	1	585	1	585
UOH84707.1|AA3_2	3.79e-314	1	585	1	568
BCS02092.1|AA3_2	4.60e-303	13	585	7	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	1.66e-253	15	584	7	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	4.74e-253	15	584	7	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	1.35e-252	15	584	7	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	3.80e-68	15	579	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.04e-67	15	579	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q988C9|4PADH_RHILO	3.34e-66	13	576	5	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q47944|SDH_GLUOY	3.79e-63	15	579	5	530	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|A1CFL2|PATE_ASPCL	2.68e-62	13	573	49	621	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|Q8G1Z8|BETA_BRUSU	7.87e-62	16	581	4	530	Oxygen-dependent choline dehydrogenase OS=Brucella suis biovar 1 (strain 1330) OX=204722 GN=betA PE=3 SV=1
sp|Q8UH55|BETA_AGRFC	2.95e-61	16	581	4	530	Oxygen-dependent choline dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=betA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999957	0.000105

TMHMM  Annotations     

There is no transmembrane helices in EXJ71997.1.