CAZyme Information: EXJ71893.1

Basic Information

• Species: Cladophialophora psammophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora psammophila
• CAZyme ID: EXJ71893.1
• CAZy Family: GH47
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352		40783.65	10.0475

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CpsammophilaCBS110553	13421	1182543	0	13421

• Gene Location: location=AMGX01000006:165989-167047(+)

Full Sequence      

MRRSLLVFLLVALIVLTLLLHSVSTLLSLLIEDASRDAIHRSELPAPNSTLLETRPHLIP
KIIHQTYINESIPAHWVPAQKSCIDLHPDYEYILWTDQKSHDFIAKEYPWFLSTFVGYRH
NIQRADAIRYFVLAHYGGVYIDLDDGCKRRLDPLLSYTAFVRRTVPTGISNDVMGSIPQH
PFFLRVMESLQGANKSWILPYITIMASTGPLFLSVIWKKWMGEHAHLDPQTWIGRVRVLM
PDEYNKHSWSFFETYKGSSWHGKDARLIFWMGKNWMLLTVLGFLLVLTVGFLTWFVYSRL
LIWSARKRSARASPRVVAFRFPVAAKMPLWRMWTGGLGSKKQTYELVAQHDA

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	79	156	1.9e-22	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	6.19e-73	41	295	63	315	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.77e-26	73	160	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS66595.1|GT32	5.67e-154	1	306	1	301
EAA57874.1|GT32	2.00e-153	1	322	1	317
AAP47108.1|GT32	2.00e-153	1	322	1	317
QSS73535.1|GT32	3.26e-153	1	306	1	301
BCS17906.1|GT32	2.39e-152	1	308	1	303

PDB Hits     

EXJ71893.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	1.56e-100	1	284	1	283	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	3.46e-98	26	284	26	275	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	9.90e-86	48	313	46	299	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	2.26e-84	31	292	50	313	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	1.28e-54	59	322	64	319	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.300608	0.699360	CS pos: 26-27. Pr: 0.3651

TMHMM  Annotations     

Start	End
5	27
275	297