CAZyme Information: EXJ71349.1

Basic Information

• Species: Cladophialophora psammophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora psammophila
• CAZyme ID: EXJ71349.1
• CAZy Family: GH43
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	AMGX01000007|CGC1	39642.74	7.0694

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CpsammophilaCBS110553	13421	1182543	0	13421

• Gene Location: location=AMGX01000007:408334-409473(+)

Full Sequence      

MKSFPPAGFLALGVALLTSSTTCSILPRQSNSKPWSVKNFNSLILFGDSYTDESRLGWFI
NHNGSAPPAGTLLPETFSAPGGGRTWPRYVVQYTGATVLGKWTPQMTLYDYAVSGAVCSN
NITPRWFPAIDAPFPSVLEYEVPAFVADIPAARVNSTPAVQLFTPKLTAQDAVYALWIGT
NDLGVYAFLTDSQIPGNVLSDYTSCVYSVFDKLYASGARHFVLMNTVPLNLAPLYANDSS
HGVGPNQYWANKTANHTEIAYTMQQFTTTVNNVFRYQTPYELLVAKRYPGARFALFDTHA
LITDIYNSPGKYLNGTGVAKGGECVWGYENHCTVDQKTCVKRQNGTNPDGYLWFDELHPR

Enzyme Prediction     

No EC number prediction in EXJ71349.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	43	359	4e-60	0.947565543071161

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	2.09e-41	42	359	1	255	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	2.44e-11	172	359	130	299	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225780	COG3240	2.02e-09	9	359	5	317	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238883	Triacylglycerol_lipase_like	1.92e-06	40	359	1	265	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA14322.1|CE16	6.26e-103	14	359	11	331
CCD46398.1|CE16	4.67e-99	9	359	33	361
ATZ51743.1|CE16	1.49e-98	9	359	48	376
APA05712.1|CE16	8.55e-97	9	359	11	339
QMW44554.1|CE16	1.17e-96	1	359	1	327

PDB Hits     

EXJ71349.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7J2C6|AES1_HYPJE	1.16e-81	39	359	26	319	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001721	0.998272	CS pos: 23-24. Pr: 0.8103

TMHMM  Annotations     

There is no transmembrane helices in EXJ71349.1.