CAZyme Information: EXJ71143.1

Basic Information

• Species: Cladophialophora psammophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora psammophila
• CAZyme ID: EXJ71143.1
• CAZy Family: GH38
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
521	AMGX01000008|CGC7	59924.13	6.3810

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CpsammophilaCBS110553	13421	1182543	0	13421

• Gene Location: location=AMGX01000008:1384297-1385862(-)

Full Sequence      

MFSMLTSVVRKRPSSILLVLFLPLITLFYFRYLVAQQHKTERLVTDLHSYVAEYPLDVAL
PDFASVANQVAALSQLAGLYMREQTLDRSRLKESLAHLFPWWNEDKLAYVPWKHQKRQKP
WLKEKEVPKTGIVVCVGDGNVEDALFLITNLKKVLKNELPIEIAYAGDSDLSPHTRTFLR
ATSKDIHFLDLSKIFDNSLIGLKGWATKPFALIASRFPRTILVDADAVFFSAPERAWDDY
EGLRDTGTLFFHDRAVTMDNSENRRRFVAEQLGKAGRAPSAHLNSSSLFYKGYIGEEADS
AVVYFDKSRPELYVTALFAAWMNVQDVRDAITWDTFWGDKESYWLAAELTGIPYAFEPWQ
AARFSEALSKQEQEVFKTPRICSPHMVHSDAADDEPFWTNMGIWQNKEDKSLGFANWTHW
YLGAPIKQTIQTTIASNLTLEPVADDSNVTLSVPKNATEVLATQAAWYWRDWTEDARGCP
QHDESRWRPLSREFLDRLRCIIAEAENIRYAWTRKKIEMNN

Enzyme Prediction     

No EC number prediction in EXJ71143.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	130	390	1.1e-41	0.9924242424242424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	9.23e-29	131	390	3	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
240125	PA_M28_1_2	0.005	218	247	17	50	PA_M28_1_2: Protease-associated (PA) domain, peptidase family M28, subfamily-1, subgroup 2. A subgroup of PA-domain containing proteins belonging to the peptidase family M28. Family M28 contains aminopeptidases and carboxypeptidases, and has co-catalytic zinc ions. The PA domain is an insert domain in a diverse fraction of proteases. The significance of the PA domain to many of the proteins in which it is inserted is undetermined. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Proteins into which the PA domain is inserted include the following members of the peptidase family M28: i) prostate-specific membrane antigen (PSMA), ii) yeast aminopeptidase Y, and ii) human TfR (transferrin receptor)1 and human TfR2. The proteins listed above belong to other subgroups; relatively little is known about proteins in this subgroup.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ65296.1|GT71	6.46e-51	131	419	105	388
CEI66537.1|GT71	1.10e-48	131	422	112	399
QRD81494.1|GT71	3.29e-48	126	424	163	457
QMW27141.1|GT71	3.29e-48	126	424	163	457
CDR35835.1|GT71	3.30e-48	35	423	66	455

PDB Hits     

EXJ71143.1 has no PDB hit.

Swiss-Prot Hits     

EXJ71143.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.990316	0.009690

TMHMM  Annotations     

Start	End
13	35