CAZyme Information: EXJ70764.1

Basic Information

• Species: Cladophialophora psammophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora psammophila
• CAZyme ID: EXJ70764.1
• CAZy Family: GH31
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:W9XK64]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
964	AMGX01000008|CGC6	106418.00	6.3071

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CpsammophilaCBS110553	13421	1182543	0	13421

• Gene Location: location=AMGX01000008:323927-327625(-)

Full Sequence      

MVGMLLAVVYTIPDKVRYIKVAARYIGLPPPETRLPSCLIGSLTLVIGLFWFAWTNYPSI
HWMASIAAGVPFGFGMVLVVLSIMNYLIDAYTIFAVLVLAASSAPLLLVWDCVPSFQHLH
LFLFSLRTASLIIIIIIIMASGGELNVEWALSQLSLEEKVGLLSGVGRCKTAGIERLNVP
SINPRTCMLPCGTALGATFDSGLLRGVGELLGDEARGKNIQVVLGPVSCLQRSPLIGRGF
EAFGEDPWLSGALAAAYIDGVQSRKVAACLKHYAAHDQSWNSIEDNCVMTERTLREMHTL
PFQIAVRQANPWSIMSSYNKINGIHVSEHKHLLDEILRDDLKWDGIVISDWWGTYSTTGS
IEAGMDLEMPGPSLWRGKLLTWAVEAGKVPRATIDRRVRAVLNFIRKVQRPPPTDIKPYN
DTPASRAFIRQVAAQSVVLLKNNDNRLPLSKSTSRTYGLIGHHFQSPAVCGGGSSEVDAY
YLNTPYDAFVEAVGESAVEYQLGCYSHRFTPLIASGHTVPGSSEPGFLVQFYGENPHDKP
DTRCLYATVSLKSSMPFNDSIPLFLPNVLFVSAKATYTPPNSGRFRFGLSISGKARLFVN
GRESIDLWSEVPEKTAATPMLNSFTMEKFVDLDLNKGESIELDVLLTNEGIHSFVVGAVP
APGLRLGVYEVLDEDETIADAIALSRRVDVPVVLSGLSSDHEFENFDRRHLRLPGRQDEL
IEKVLDANPNTIVVTQSGLPVGMPWLPKANALLHAWFGGQETGHGITDVVFGDVNPSARL
SVTFPKRVEDTPTYLTYGKSDKNILYGEGVFIGHRYYEQVDREPLFYFGYGLTYSRFEYS
NLQVPSEFEAREDHVMRLSVRVSNVGTVDGSEIVQVYVGDAHCTVLRPKKELKAFAKAKI
ASGQSKEIEVELDKYAVSYWSEVHGKWMAEAGVFTVIISRSADPRDHVLSADFTLPQTFL
WTGQ

Enzyme Prediction     

No EC number prediction in EXJ70764.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	188	370	1.4e-57	0.8657407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.45e-65	185	955	117	764	beta-glucosidase BglX.
224389	BglX	2.23e-61	188	463	82	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.13e-48	649	813	50	215	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	4.54e-38	151	913	57	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	3.06e-37	188	403	87	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62631.1|GH3	0.0	139	963	1	839
QGJ01758.1|GH3	1.85e-314	139	963	1	820
UPK95841.1|GH3	3.50e-314	139	963	1	838
CCT75598.1|GH3	8.59e-312	139	963	1	836
QGI70868.1|GH3	6.34e-310	146	963	294	1106

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.77e-174	144	963	3	844	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.01e-170	144	963	3	844	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	6.76e-129	145	958	3	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.55e-94	150	955	8	663	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	6.82e-88	147	932	70	807	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BA18|BGLK_EMENI	3.63e-196	142	963	8	837	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
sp|A1DFA8|BGLI_NEOFI	5.12e-196	144	963	3	837	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	5.69e-195	144	963	3	837	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	5.69e-195	144	963	3	837	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	3.18e-194	144	963	3	837	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999921	0.000084

TMHMM  Annotations     

Start	End
33	55
62	84
88	110
123	145