CAZyme Information: EXJ70761.1

Basic Information

• Species: Cladophialophora psammophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora psammophila
• CAZyme ID: EXJ70761.1
• CAZy Family: GH31
• CAZyme Description: murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
478		55314.70	6.4099

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CpsammophilaCBS110553	13421	1182543	0	13421

• Gene Location: location=AMGX01000008:316088-317575(+)

Full Sequence      

MSPPTNSGFLRVQGDHIVNGSGQRVSLRGTSLGGWLCMENFMTGFPGTESAMRSALLKVL
GKADYEYFFDRFLYHFFTEKDAQFLKSLGFNCLRLPCSHKHLDDDMNPRIFIREGVGFKH
LNRVINICANAGIYVVLDLHTAPGCQNPDWHSDNNTSYAAFWDFKDHQDRLVWLWKELAS
IYKGNPWVAGYDPMNEPCDPQHLRLPAFYDRLIKEIRQADPDHIIFLEGNTFAMEWRGFE
TIINTPNCVYSVHDYATMGFPSAPGPYEGHQEQKEKLERQFRRKCDFLNKHNLPIWNSEF
GCPWAQPNWDPDIEALDRKKYAMIDAQLEIYERADIAAWAIWSYKDIGVMGILNASRQSP
LSKLVEQLGETKKQLHLDSALMYPNQEIEDAITPLIDWINKHAPNASHTYPTIWNTRTHV
VRNVIHSFVANTFCEEYAQKFQGLSRNALEDLAKSFAFDQCVQREELYSILKKYTFEK

Enzyme Prediction     

EC	3.2.1.4:2	3.2.1.37:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	53	347	5.4e-111	0.9965034965034965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	3.74e-22	76	301	23	237	Cellulase (glycosyl hydrolase family 5).
225344	BglC	3.12e-14	76	255	73	254	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK94769.1|GH5_22	2.07e-195	6	474	2	462
CAP80303.1|GH5_22	1.33e-192	7	472	3	462
QMW26442.1|GH5_22	4.27e-189	6	474	2	464
QMW38521.1|GH5_22	4.27e-189	6	474	2	464
UCK59003.1|GH5_22	6.28e-189	6	474	13	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ECE_A	4.51e-16	85	344	53	321	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
1VRX_A	1.96e-15	85	344	53	321	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]
4LX4_A	7.81e-10	74	303	35	256	Crystal Structure Determination of Pseudomonas stutzeri endoglucanase Cel5A using a Twinned Data Set [Pseudomonas stutzeri A1501],4LX4_B Crystal Structure Determination of Pseudomonas stutzeri endoglucanase Cel5A using a Twinned Data Set [Pseudomonas stutzeri A1501],4LX4_C Crystal Structure Determination of Pseudomonas stutzeri endoglucanase Cel5A using a Twinned Data Set [Pseudomonas stutzeri A1501],4LX4_D Crystal Structure Determination of Pseudomonas stutzeri endoglucanase Cel5A using a Twinned Data Set [Pseudomonas stutzeri A1501],6R2J_A Crystal Structure of Pseudomonas stutzeri endoglucanase Cel5A in complex with cellobiose [Pseudomonas stutzeri A1501],6R2J_B Crystal Structure of Pseudomonas stutzeri endoglucanase Cel5A in complex with cellobiose [Pseudomonas stutzeri A1501],6R2J_C Crystal Structure of Pseudomonas stutzeri endoglucanase Cel5A in complex with cellobiose [Pseudomonas stutzeri A1501],6R2J_D Crystal Structure of Pseudomonas stutzeri endoglucanase Cel5A in complex with cellobiose [Pseudomonas stutzeri A1501]
6ZB9_A	3.25e-09	25	229	1	204	Chain A, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
3AMC_A	7.29e-09	85	301	42	255	Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W8QRE4|XYL5_PHACH	7.79e-146	9	471	3	465	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
sp|P54583|GUN1_ACIC1	5.76e-15	85	344	94	362	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|A1D4Q5|EXGA_NEOFI	1.99e-14	27	351	42	390	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1
sp|A1CRV0|EXGA_ASPCL	4.70e-14	10	351	27	389	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
sp|B0XN12|EXGA_ASPFC	6.30e-14	27	241	42	260	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EXJ70761.1.