CAZyme Information: EXJ70614.1

Basic Information

• Species: Cladophialophora psammophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora psammophila
• CAZyme ID: EXJ70614.1
• CAZy Family: GH30
• CAZyme Description: murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492		54021.59	7.8003

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CpsammophilaCBS110553	13421	1182543	0	13421

• Gene Location: location=AMGX01000009:1391228-1392827(-)

Full Sequence      

MTFSPLIAIALAIFATFLRPVSGDSSSACNPLNGPCPAIPGLATGEYFMDFTQQTTTPSD
WILADYANVGYGPNGANFTFAKRYDAPYIWTRFYVLFGRIEVVVQAAPGAGIITSSVMMS
DDLDEIDWEWSGNNFAGSSGAVQTNYFGKGQVGNSDRGSQPVVDDPEHKFHTYALDWQPD
KLVWSIDGVAVRTLKNNGATTGSYQYPQTPSRLHLGLWCSGDPSTPYGTVYWGGGYTNFS
AAPFSAYVKSVKITTNNVCSSWQYPSPFDGTYPSVQCTNQTIALPCTYTVVTGDDGSKIA
KNLTVNFDSLKGVNPGVNWDQLLVGQVLNVPGGTCQTSTTTTMSATSGISSSMASSAKFS
STASFTSNLTNSMSASILKLDFFKPNSFINSASKLFKLAIFSESNNKCNNFGTTILEFHP
RCHGNFYLSFDHGHLDYWHQLAYYGLHDSWRRRLRHRRHNNIVSSFSIHKLLHRGCRRLW
LGYCERIGLLLG

Enzyme Prediction     

No EC number prediction in EXJ70614.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	74	235	9.7e-59	0.9873417721518988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	2.52e-84	50	254	2	200	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	6.33e-46	68	230	5	162	Glycosyl hydrolases family 16.
185683	Glyco_hydrolase_16	9.84e-21	50	254	2	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
225182	BglS	3.11e-18	90	250	111	268	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185684	GH16_lichenase	4.22e-18	68	255	33	212	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR46394.1|GH16_18	8.82e-76	1	276	1	282
SMY21548.1|GH16_18	8.82e-76	1	276	1	282
SMR47644.1|GH16_18	8.82e-76	1	276	1	282
SMQ47861.1|GH16_18	8.79e-75	1	276	1	282
CAA11266.1|GH16_18|2.4.1.-	3.52e-72	12	276	18	274

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	2.23e-73	27	276	2	243	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
3D6E_A	4.71e-13	97	254	59	199	Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis],3D6E_B Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis]
1GBG_A	2.00e-12	97	254	72	212	Bacillus Licheniformis Beta-Glucanase [Bacillus licheniformis]
3O5S_A	1.77e-11	97	254	96	236	Crystal Structure of the endo-beta-1,3-1,4 glucanase from Bacillus subtilis (strain 168) [Bacillus subtilis]
1UMZ_A	3.05e-10	96	253	58	210	Xyloglucan endotransglycosylase in complex with the xyloglucan nonasaccharide XLLG. [Populus tremula],1UMZ_B Xyloglucan endotransglycosylase in complex with the xyloglucan nonasaccharide XLLG. [Populus tremula],1UN1_A Xyloglucan endotransglycosylase native structure. [Populus tremula],1UN1_B Xyloglucan endotransglycosylase native structure. [Populus tremula]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8J0P4|CRF1_ASPFU	9.64e-72	12	276	8	264	Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf1 PE=1 SV=2
sp|D4ALQ5|CRH11_ARTBC	2.65e-55	21	279	15	260	Probable extracellular glycosidase ARB_05253 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05253 PE=1 SV=2
sp|P53301|CRH1_YEAST	1.76e-53	27	282	38	282	Probable glycosidase CRH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRH1 PE=1 SV=1
sp|D4B4J2|CRH12_ARTBC	1.52e-51	10	276	12	270	Probable extracellular glycosidase ARB_03382 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03382 PE=3 SV=2
sp|Q5AFA2|CRH11_CANAL	6.14e-49	11	276	6	261	Extracellular glycosidase CRH11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRH11 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000180	0.999811	CS pos: 23-24. Pr: 0.9803

TMHMM  Annotations     

There is no transmembrane helices in EXJ70614.1.