CAZyme Information: EXJ70062.1

Basic Information

• Species: Cladophialophora psammophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora psammophila
• CAZyme ID: EXJ70062.1
• CAZy Family: GH28
• CAZyme Description: murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311	AMGX01000010|CGC2	33247.89	4.0210

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CpsammophilaCBS110553	13421	1182543	0	13421

• Gene Location: location=AMGX01000010:1131823-1132863(+)

Full Sequence      

MLLLPLACLAFIGFASPILAQSGFAHVIVGNTYSYTQASWASDIAAATAAGIDGFALNIA
YADTINSNGYVQAYVTAPDGRPYMMPVSPWFYTNLPLWSKNWLWRGDDLWHDRWDQVLDE
QPAFVEILTWNDWGESHYIGPIPPTDSAIPDGAGPYVMNNPHDAWLKDLPHYIAAYKNTS
RPDESHITFWYRLNPASGSACGAGTTCNTPTQGQVALSTQECDIDAVFFTAFVPDTAVAT
VNVTIGGSTQTVSAGTPGIFHSNVPFADLTGDVTVSVTTSDGTETGPVNGAPISTDCPGG
NVNWNAWVGGS

Enzyme Prediction     

EC	3.2.1.59:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH71	72	280	2e-66	0.5333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397634	Glyco_hydro_71	1.59e-84	24	283	2	369	Glycosyl hydrolase family 71. Family of alpha-1,3-glucanases.
211418	GH71	1.63e-53	24	178	8	282	Glycoside hydrolase family 71. This family of glycoside hydrolases 71 (following the CAZY nomenclature) function as alpha-1,3-glucanases (mutanases, EC 3.2.1.59). They appear to have an endo-hydrolytic mode of enzymatic activity and bacterial members are investigated as candidates for the development of dental caries treatments.The member from fission yeast, endo-alpha-1,3-glucanase Agn1p, plays a vital role in daughter cell separation, while Agn2p has been associated with endolysis of the ascus wall.
211414	GH99_GH71_like	2.88e-24	80	174	189	284	Glycoside hydrolase families 71, 99, and related domains. This superfamily of glycoside hydrolases contains families GH71 and GH99 (following the CAZY nomenclature), as well as other members with undefined function and specificity.
211416	GH99_GH71_like_3	0.004	108	141	276	309	Uncharacterized glycoside hydrolase family 99-like domain. This family of putative glycoside hydrolases resembles glycosyl hydrolase families 71 and 99 (following the CAZY nomenclature) and may share a similar catalytic site and mechanism.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT04617.1|GH71	1.37e-106	72	311	192	433
CAK40416.1|GH71	1.03e-74	72	311	175	419
BCS11256.1|GH71	1.95e-74	15	311	48	469
BCR98944.1|GH71	1.95e-74	15	311	48	469
BCR90909.1|GH71	3.87e-70	72	311	154	409

PDB Hits     

EXJ70062.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13716|AGN1_SCHPO	2.76e-29	80	265	209	380	Glucan endo-1,3-alpha-glucosidase agn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn1 PE=1 SV=2
sp|B6GX22|MU71A_PENRW	1.54e-26	80	277	215	391	Mutanase Pc12g07500 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=PCH_Pc12g07500 PE=1 SV=1
sp|O94510|AGN2_SCHPO	9.74e-14	81	266	202	382	Ascus wall endo-1,3-alpha-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000224	0.999743	CS pos: 20-21. Pr: 0.9780

TMHMM  Annotations     

There is no transmembrane helices in EXJ70062.1.