CAZyme Information: EXJ70030.1

Basic Information

• Species: Cladophialophora psammophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora psammophila
• CAZyme ID: EXJ70030.1
• CAZy Family: GH27
• CAZyme Description: GH18 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:W9WY96]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
821		84076.17	4.1705

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CpsammophilaCBS110553	13421	1182543	0	13421

• Gene Location: location=AMGX01000010:1046721-1049239(-)

Full Sequence      

MDIIPIGFVNVFPDQADGPGTNYGNACGGATWQSPDGTMTSVYTTCYQIAEDIPICQAMG
KKIFASIGGASPGNFIASSDSAKAFADFLWGSFGPLQDPTMVEYPRPFGLTTVVDGFDLD
IESGGDFGYADLVNELRAKFTEDSSKTYYISSAPQCVVPDAHLDDAIKNSMIDYVFVQYY
NTDQCSAASLFSSGALDTTTDITFGWADWLKGNSMNQDIKMFLGLPASTSAANPNYYLDL
DQAQALIEEYACSSTYQNIFAGVMLWEATYSDNNQINGKSYAGNIKDIFGQLSCRPPTTT
TTSTTTTTTTTSTTTTTTTTTTTTTTTTTTTTSTIPTTTPTTTTTTTTTTTSTTSTIPTT
TPETTSTTSVSLAVPTSTSSSTTSSSESPVETTSSTTSVAPVTTTTTTSSETTTSSYNHG
PGGGSTTSSSSETTTTSSYNHGPGGESTTSSSETATTTSYTNGPVGGSTTSSSSSSSTTT
TTTTTTTASSESFSPVGRTSSPTSSSHPTTSYSHPVEVTTSLSSSSATSSPAETTSSYSH
PYGHSSSSTSSRYVGPATTSSSSSATYTTSYQWADWTSSSSSPVGAVTTKASTTSGHVTW
GDWTTSSTTSSPAGEYTVTVWTTEYTDIGPHGFTKHPFHLTTTVPVSPATTTAPFVWPTK
ADGCPRGFHTTETVCYVCGPGMTTVTLTVPMPTATATAVMTQTVVPVKPTGEAAAPEHPS
GTASTETPVAAATGAAGWSYSQPAGGPANTATPVAAASISPASNSGWLAPSGTPVAAASS
TPVAPINVTPFTGGAAAQSQLPGTVLSVVICAAVAVTGLFL

Enzyme Prediction     

EC	3.2.1.14:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	8	299	6.8e-21	0.6722972972972973

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119356	GH18_hevamine_XipI_class_III	4.11e-89	2	287	26	280	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
395573	Glyco_hydro_18	1.50e-15	30	233	31	228	Glycosyl hydrolases family 18.
119349	GH18_chitinase-like	1.53e-09	6	181	2	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
223021	PHA03247	4.67e-08	680	802	2710	2836	large tegument protein UL36; Provisional
119363	GH18_CTS3_chitinase	8.24e-08	43	207	58	207	GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii. CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAO61685.1|GH18	1.50e-80	1	297	53	343
EAL85930.1|GH18	1.58e-79	1	297	53	343
QSS69866.1|GH18	5.45e-75	1	298	54	347
BCR90928.1|GH18	2.28e-74	1	296	52	344
BAE61604.1|GH18	1.81e-72	1	297	53	343

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XVN_A	8.05e-87	1	288	25	306	A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_B A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_C A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus]
4TX6_A	8.31e-87	1	288	26	307	AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163],4TX6_B AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163]
2XTK_A	8.31e-87	1	288	26	307	ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XTK_B ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XUC_A Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_B Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_C Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XVP_A ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163],2XVP_B ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163]
2UY2_A	3.52e-52	2	293	33	291	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
6IDN_A	2.15e-28	2	273	26	263	Crystal structure of ICChI chitinase from ipomoea carnea [Ipomoea carnea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q873Y0|CHIA1_ASPFM	2.67e-81	1	297	53	343	Endochitinase A1 OS=Neosartorya fumigata OX=746128 GN=chiA1 PE=1 SV=1
sp|Q4WEP7|CHIA1_ASPFU	2.80e-80	1	297	53	343	Endochitinase A1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chiA1 PE=3 SV=1
sp|A2QUQ2|CHIA1_ASPNC	3.32e-72	1	297	52	344	Endochitinase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=ctcA PE=2 SV=1
sp|P54197|CHI2_COCP7	1.49e-69	2	298	54	346	Endochitinase 2 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS2 PE=3 SV=2
sp|Q1EAR5|CHI2_COCIM	2.52e-69	2	298	54	346	Endochitinase 2 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS2 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999883	0.000166

TMHMM  Annotations     

There is no transmembrane helices in EXJ70030.1.