CAZyme Information: EXJ69793.1

Basic Information

• Species: Cladophialophora psammophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora psammophila
• CAZyme ID: EXJ69793.1
• CAZy Family: GH2
• CAZyme Description: alpha 1,3-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
930		105028.93	5.8030

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CpsammophilaCBS110553	13421	1182543	0	13421

• Gene Location: location=AMGX01000010:411072-413864(-)

Full Sequence      

MTEKGGPESSPYQLDAASIKFKHGRLDGSVIKSLVGGDTVKLPLTMTFLDRGNVRVTIDE
EKRRKGEIELRQGSVARKERYNEVGTWALTGAGLHPQTTAEMKKVSKDVTEVSWGPGGHF
KASIRHAPFGIEFWSGEEKHVVLNGRGFLNVEHWRPKIEQPVVDDNSTEPPPTEPTEDES
TWWDESFGGNTDSKPKGPESVAMDITFPGYAHVYGLPEHAGPLSLKETRGGDEHYDQPYR
MYNSDVFEYELDSPMTLYGSIPFMHAHKKGSTVGVFWLNAAETWVDIVKSKHDTNPLTLG
LTGGVVDTQTHWISESGLLDVFVMLGPTPQEVSKSYGELTGYTTMPASFAIAYHQCRWNY
VSDEDVKDVDRKFDKFNIPYDVIWLDIEYTDDKKYFTWDPLNFPDPISMEKQLDETQRKL
VVIIDPHIKNKEGYFVADELKSKDLAVKNKENNIFEGWCWPGSSYWIDAFNPAARAWWKS
LFTFDRFKGTQSNVWLWNDMNEPSVFNGPEITMPRDNLHHGNWEHRDLHNINGMTFHNAT
YHALLERKKGETRRPFVLTRSFYSGSQRSAAMWTGDNQASWEHLAASIPMILNQGVGGFP
FAGADVGGFFGNPSKELQTRWYQAGAFYPFMRGHAHIDTRRREPYMLGEPYTSIMTQALR
LRYSLLPAWYTAFHEAATDGYPIVRAQYFVHPTDDKGFDIDDQMYLGSTGLLVKPVTIEG
GESVDIYLADDENYYDYFDYTIYAGGSRTHKVDAPLDKIPLLMQGGHIFPRKERPRKSSG
LMKWDPYTLVVVLDKQGEKAEGTLYVDDGETFDYQQGAYIHRNFSVAGGVLRSSDIGTKG
AKTAGYLKTMKEVKIEKIVVVNAPAAWSSAGEIRVTEDGIKEDRKVEMIYHSAAGNKTAW
AVVRNPGMGIGVDWSMKFPESADSGPKTEL

Enzyme Prediction     

EC	3.2.1.20:27	3.2.1.84:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	322	768	1.2e-148	0.9929742388758782

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395838	Glyco_hydro_31	0.0	322	768	1	441	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269889	GH31_GANC_GANAB_alpha	0.0	341	811	1	467	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
224418	YicI	2.83e-178	197	866	139	765	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
269890	GH31_glucosidase_II_MalA	6.24e-142	341	680	1	339	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
215408	PLN02763	2.70e-114	327	925	164	752	hydrolase, hydrolyzing O-glycosyl compounds

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAF2179891.1|GH31	0.0	9	918	63	985
QRD05297.1|GH31	0.0	9	920	63	986
QVM11559.1|GH31	0.0	1	918	26	934
CAK40395.1|GH31	0.0	4	918	52	957
CAS97680.1|GH31	0.0	4	918	52	957

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DKX_A	0.0	10	918	37	950	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DKY_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5JQP_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
5DKZ_A	0.0	10	918	37	950	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DL0_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
5IEF_A	2.22e-237	118	916	113	909	Murine endoplasmic reticulum alpha-glucosidase II with N-butyl-1-deoxynojirimycin [Mus musculus]
5IEG_A	2.30e-237	118	916	113	909	Murine endoplasmic reticulum alpha-glucosidase II with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]
7KRY_A	2.99e-237	118	929	144	952	Chain A, Neutral alpha-glucosidase AB [Mus musculus],7KRY_C Chain C, Neutral alpha-glucosidase AB [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9US55|GLU2A_SCHPO	2.99e-281	18	858	64	881	Glucosidase 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gls2 PE=1 SV=1
sp|Q94502|GANAB_DICDI	1.83e-243	182	917	234	941	Neutral alpha-glucosidase AB OS=Dictyostelium discoideum OX=44689 GN=modA PE=3 SV=1
sp|Q9FN05|PSL5_ARATH	1.03e-239	120	917	150	919	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1
sp|Q8BHN3|GANAB_MOUSE	3.06e-236	118	916	145	941	Neutral alpha-glucosidase AB OS=Mus musculus OX=10090 GN=Ganab PE=1 SV=1
sp|P79403|GANAB_PIG	4.35e-233	7	916	55	941	Neutral alpha-glucosidase AB OS=Sus scrofa OX=9823 GN=GANAB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EXJ69793.1.