CAZyme Information: EXJ68195.1

Basic Information

• Species: Cladophialophora psammophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora psammophila
• CAZyme ID: EXJ68195.1
• CAZy Family: GH13
• CAZyme Description: glucan 1,3-beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308	AMGX01000014|CGC2	33096.41	4.1373

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CpsammophilaCBS110553	13421	1182543	0	13421

• Gene Location: location=AMGX01000014:706090-707182(+)

Full Sequence      

MQLRDVLSTALATAPLAVSAAGTLGFAVGNTNPDGTCKTQSDFEADFKAILSNTDAQLVR
TYSSSDQYGNPCHTPSEVLPAAKSAGIKVLLGMWPDGGAYDKEKAAVDEADPTSYGDTLY
GITIGSEGMYRGTYNAGELLGWIADMQKSYPNTQLGTADSWNCWNNGTMDSIIQSGIQLV
LANGFAYWQYQDISNATKTYFDDMAQALGHVQEVSGSLDKIHFMNGETGWPGTGGSDAGA
AKAGDNNMKTYWQSAVCGILDWGIDLFWFEAFDEPNKANAIGDNGQSASEQHWGSFTSDR
QPKFDMHC

Enzyme Prediction     

No EC number prediction in EXJ68195.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	76	308	9.2e-30	0.8810289389067524

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.66e-52	8	300	30	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.25e-24	29	308	9	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX02470.1|GH17	1.95e-110	8	308	9	303
SMR45377.1|GH17	1.48e-106	6	308	6	305
SMQ46852.1|GH17	1.48e-106	6	308	6	305
SMR43216.1|GH17	2.77e-104	7	308	7	305
SMY20536.1|GH17	2.77e-104	7	308	7	305

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.63e-22	34	303	46	289	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.13e-21	34	303	46	289	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B2W4|BGL2_ARTBC	1.24e-92	1	308	1	301	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1
sp|P15703|BGL2_YEAST	1.39e-62	8	308	4	310	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|Q5AMT2|BGL2_CANAL	9.14e-56	9	308	7	305	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P43070|BGL2_CANAX	1.29e-55	9	308	7	305	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|O13990|BGL2_SCHPO	1.24e-52	5	308	23	318	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000738	0.999199	CS pos: 20-21. Pr: 0.9659

TMHMM  Annotations     

There is no transmembrane helices in EXJ68195.1.