CAZyme Information: EXJ67722.1

Basic Information

• Species: Cladophialophora psammophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora psammophila
• CAZyme ID: EXJ67722.1
• CAZy Family: GH13
• CAZyme Description: murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467	AMGX01000015|CGC2	54771.66	6.2512

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CpsammophilaCBS110553	13421	1182543	0	13421

• Gene Location: location=AMGX01000015:380583-382177(-)

Full Sequence      

MAAGYLRVDGDKIVDGNGHHVVLRGAAIGGWMNMENFITGYPGHESQHRASMRKVLGDEK
AEFFFDKWLEYHFTEADARFFASLKLNCIRLPFNYRHLEDDMNPRVLKESGFKHLDRVID
LCAKHQIYTILDMHTAPGGQNPDWHSDNPTNYAAFWDYKDHQDRTIWLWQEIAKRYRDNT
WVAGYNPINEPCDPEHVRLPAFYKRIEAAIRAMDNHHILWLDGNTFSMEWKGFDEVLANC
VYALHDYSMMGFPTGERYKGTDDQNSKLDRQFLRKAAFMLEHKCPIWNGEFGPVYADPAE
DEDAEAINQDRYNMLGQQFKVYDKYKISWSIWLYKDIGVQGMVHTSRDSKWNRTIQSFLD
KKKRYRLDAWGVHHAPEAEAVLNPLVEWIDKICPTAKDAYPSPWQTERHLMRAVIQTWLS
AQFSDEFARQFEGMDFKELDELAHSFHFDECVQRNGLNKILSEHAPQ

Enzyme Prediction     

EC	3.2.1.4:2	3.2.1.37:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	49	337	3.1e-127	0.9965034965034965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	4.41e-18	74	336	26	270	Cellulase (glycosyl hydrolase family 5).
225344	BglC	7.83e-11	74	192	75	192	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW26442.1|GH5_22	1.49e-276	1	465	1	465
QMW38521.1|GH5_22	1.49e-276	1	465	1	465
UCK59003.1|GH5_22	2.25e-276	1	465	12	476
CAP80303.1|GH5_22	1.31e-272	1	465	1	465
QBZ65040.1|GH5_22	3.08e-244	1	465	1	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	5.65e-21	74	335	30	316	Chain A, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	1.40e-20	74	335	30	316	Chain A, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
2PF0_A	7.51e-09	16	194	1	196	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PC8_A	7.51e-09	16	194	1	196	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PB1_A	7.51e-09	16	194	1	196	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W8QRE4|XYL5_PHACH	6.32e-185	5	465	3	469	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
sp|P23340|GUNC_CLOSF	1.17e-20	74	335	30	316	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
sp|A3DJ77|GUNC_ACET2	1.17e-20	74	335	30	316	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
sp|P0C2S3|GUNC_ACETH	2.91e-20	74	335	30	316	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
sp|Q5B5X8|EXGA_EMENI	7.41e-15	23	276	29	288	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EXJ67722.1.