CAZyme Information: EXJ67650.1

Basic Information

• Species: Cladophialophora psammophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora psammophila
• CAZyme ID: EXJ67650.1
• CAZy Family: GH128
• CAZyme Description: glycosyl hydrolase family 10

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395		42460.56	4.2063

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CpsammophilaCBS110553	13421	1182543	0	13421

• Gene Location: location=AMGX01000015:153516-154982(-)

Full Sequence      

MSLARLASVVSALAALGLASPAGPGWPPHGHYPPPPPPPPPPPLTPATATSSASLAPASS
APASCSGYFEPLSPPFLNDLAQAAGKLWFGSATDQPGTGEDTSILYQEILNNTHIFGQIT
PANMMKFELSEPEPGVFNFTGGDIDVAIARDHGKYLRCHNLVWVSQVSDWVLNGNWTEDS
LIAVMQNHIQTMITHFGDACYSWDVVNEAVAANGSFSSSIWFDVIGPEYFFLAFQFAQEA
VDSLPAGIRKPKLYYNDFGIESGNKSVAVLGLIQELQSRNIRIDGVGLESHFVLGETPSL
QDQIATKQAYIAAGVEVAITELDIRFPQANLTNATAFALQAEEYYNSTASCVQVGGCVGI
TVWDFDDQYSWIPSSFPGQGLADLYNADFRVSNHP

Enzyme Prediction     

EC	3.2.1.8:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	77	389	7.6e-75	0.9537953795379538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	1.54e-98	77	389	1	299	Glycosyl hydrolase family 10.
214750	Glyco_10	2.84e-81	125	391	1	256	Glycosyl hydrolase family 10.
226217	XynA	1.30e-64	114	380	56	317	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW72084.1|GH10|3.2.1.8	3.83e-135	77	391	31	345
QBQ52894.1|GH10	1.04e-123	72	390	36	353
QZB01317.1|GH10	4.25e-123	77	391	28	340
ACP27611.1|GH10|3.2.1.8	1.01e-121	77	386	29	336
ACS96449.1|GH10|3.2.1.8	3.18e-107	77	385	87	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4F8X_A	1.50e-123	77	386	4	311	Penicillium canescens endo-1,4-beta-xylanase XylE [Penicillium canescens]
5XZO_A	6.22e-110	77	385	3	310	Chain A, Beta-xylanase [Bispora sp. MEY-1],5XZO_B Chain B, Beta-xylanase [Bispora sp. MEY-1],5XZU_A Chain A, Beta-xylanase [Bispora sp. MEY-1],5XZU_B Chain B, Beta-xylanase [Bispora sp. MEY-1]
6JDT_A	1.73e-89	77	380	3	295	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
6Q8M_A	4.40e-83	77	382	25	319	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
3U7B_A	7.78e-69	77	390	5	312	A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_B A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_C A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_D A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_E A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ZNB1|XYND_TALFU	7.49e-87	77	390	21	322	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1
sp|Q9HEZ1|XYNA_PHACH	3.78e-81	77	389	94	393	Endo-1,4-beta-xylanase A OS=Phanerodontia chrysosporium OX=2822231 GN=xynA PE=1 SV=1
sp|B7SIW2|XYNC_PHACH	8.19e-81	54	389	61	384	Endo-1,4-beta-xylanase C OS=Phanerodontia chrysosporium OX=2822231 GN=xynC PE=1 SV=1
sp|P79046|XYN1_HUMGT	1.86e-77	77	390	21	325	Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea OX=5528 GN=xyn1 PE=2 SV=1
sp|G4MLU0|XYN5_MAGO7	2.66e-77	77	390	38	341	Endo-1,4-beta-xylanase 5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=XYL5 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000317	0.999637	CS pos: 19-20. Pr: 0.9608

TMHMM  Annotations     

There is no transmembrane helices in EXJ67650.1.