CAZyme Information: EXJ67310.1

Basic Information

• Species: Cladophialophora psammophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora psammophila
• CAZyme ID: EXJ67310.1
• CAZy Family: GH1
• CAZyme Description: CAP10 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:W9WQP7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
669	AMGX01000016|CGC1	76730.66	6.4403

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CpsammophilaCBS110553	13421	1182543	0	13421

• Gene Location: location=AMGX01000016:131560-133569(-)

Full Sequence      

MTYGALEMTAYLTAFTTTIPAFEFIWSHRNPFPQTPSSATTLSFLLIFFGQWAYRWIQQE
LGDKDPMRSSRQFLLFVVLCVLIFPLWLKKDYVHFHPIDMLMYDATLHHNKYLETVGSTS
SLAEAVNGYTQRYNRNPPPGFDVWFEYAKNRSVLIVDEYDQIYHDLLPFRAISPADLRRQ
TWEMVSNPWNEISGITIRDGEAKVQENVLPTHRWMLEGVAVLINSFAQHLPDMDLAFNLN
DESRVAVPYEQIKSLREQGRAQDKSGSSSWSNDRAGGWLPIPETERTETVFRDNSWRNSF
RAFGSIGCPPSSFARTSPHISSQSHICSSCVAPHSLGQFVGNWSDAADICHQPDIAHLHG
FYLSPAAFKTSYQLMPVFSQSKPHAYNDILYPSAWNYMDKVVYAPTNPQGTPGQEVYHAG
FPDLPFEEKENILFWRGATSEGVSSDSGAWRGMARQRLVHMANNLTNHPHDAVTVLLPSP
ADHSKYQYQTIPGAQVKKLGLQTDIAIVDFIARCGGKDCTDQSQEFNLVSPTDFQAHWRY
RFLFDLDGAGFSGRFLPFLYSHSLPFKTALFREWYDSRLTAWLHFVPQDIRLHDVWSSLA
YFAGVNGTMFGHKIWWKPHLKEAEMIAEAGRDWAAKVLRKEDMECYFFRLLLEWARLSDD
NRDELGFVL

Enzyme Prediction     

No EC number prediction in EXJ67310.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	353	658	3.9e-70	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	4.31e-15	376	657	32	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	4.36e-08	376	657	108	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO14774.1|GT90	1.21e-230	6	669	334	1005
USW54735.1|GT90	6.28e-218	4	668	323	984
BCS08186.1|GT90	1.82e-214	3	669	332	995
BCR84315.1|GT90	3.63e-214	4	669	342	997
QVM13461.1|GT90	7.86e-214	6	669	307	965

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	4.86e-06	376	657	154	378	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	5.71e-06	375	661	117	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	4.04e-43	96	663	152	661	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q6UW63|PLGT2_HUMAN	3.51e-07	528	658	350	467	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	1.15e-06	537	664	279	397	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q9JHP7|PLGT2_MOUSE	1.85e-06	521	658	343	467	Protein O-glucosyltransferase 2 OS=Mus musculus OX=10090 GN=Poglut2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000020	0.000000

TMHMM  Annotations     

Start	End
5	27
37	56
69	88