CAZyme Information: EXJ66180.1

Basic Information

• Species: Cladophialophora psammophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora psammophila
• CAZyme ID: EXJ66180.1
• CAZy Family: AA7
• CAZyme Description: GMC_OxRdtase_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:W9WME4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
606		66446.35	6.9931

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CpsammophilaCBS110553	13421	1182543	0	13421

• Gene Location: location=AMGX01000021:424384-426451(+)

Full Sequence      

MDGFVPVNTDILIAGGGTTGLVVATRLAKANPHLSITVLESGIGVRDDPSIVHPALYLSN
ILPGSKTATFYTSKSSESLAGRELVIPTGGCLGGGSSINFMVYSRPQMIDFDDWKTEGWR
GEDMVPFLKVYENFQDHDPGIDKSLHGYGGEFSISPGTNAQTTFQEDYFEACRQIGIPQV
PDVQNLKTSHAVGRWNMWVDQKTGRRQDVPHRLLYPLLDAYKTGLQVFTNIKVVRVLFNE
QKRATGVEYVPVGPDSHAKPSVINATKLVVLASGTFGTPQILQRSGVGDAHRLSKLGINV
VSNLPGVGQNYQDHHVIFYPYRSAAGPSETIDGIISGRFTLESALEQKKAQPTRYLLGWN
GLDCVGKIRPSAGDEELLGPELRELWERDYRPRPTRPLMLMSSLAAFVGDHTGIPPGQHF
SLGPYTPYPYSRGSIHITGPTVSDPPDFDCGFLNHPADIQKLLWGYKKQREIARLMTHYR
GALEVGHPVFSKESKAGFKFVDDQDRKTGRYQPIEYSEKDDQAIELFIRQNVSTAWHSMG
TCAMKTKEQGGVVDPGLNVFGVQGLKVVDLSICPSNVSANTYATALTVGHKAASIIAEEL
GLSYPI

Enzyme Prediction     

EC	1.1.3.13:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	9	601	1.3e-226	0.9949152542372881

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.69e-74	10	603	9	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.10e-66	10	596	7	531	choline dehydrogenase; Validated
366272	GMC_oxred_N	3.46e-34	81	316	16	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	8.38e-33	429	592	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.92e-15	225	601	235	582	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX56294.1|AA3_3	1.32e-278	5	606	7	607
QSS52715.1|AA3_3	2.08e-268	8	603	5	600
QSS70720.1|AA3_3	2.40e-267	8	603	5	600
QSS72389.1|AA3_3	3.26e-262	8	604	5	602
QGA18712.1|AA3_3	3.06e-260	5	603	7	603

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6H3G_A	6.95e-161	6	602	4	626	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
6H3O_A	1.11e-159	6	602	4	626	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
5HSA_A	6.38e-141	5	603	3	639	Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_B Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_C Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_D Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_E Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_F Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_G Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_H Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5I68_A Chain A, Alcohol oxidase 1 [Komagataella pastoris]
6YRU_AAA	1.22e-47	10	596	9	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6ZH7_A	1.22e-47	10	596	9	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00922|ALOX_CANBO	5.29e-145	5	603	3	639	Alcohol oxidase OS=Candida boidinii OX=5477 GN=AOD1 PE=1 SV=1
sp|P04841|ALOX_PICAN	1.92e-142	5	603	3	640	Alcohol oxidase OS=Pichia angusta OX=870730 GN=MOX PE=1 SV=1
sp|F2QY27|ALOX1_KOMPC	3.28e-140	5	603	3	639	Alcohol oxidase 1 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX1 PE=1 SV=1
sp|P04842|ALOX1_KOMPG	3.28e-140	5	603	3	639	Alcohol oxidase 1 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX1 PE=1 SV=2
sp|F2R038|ALOX2_KOMPC	1.30e-139	5	601	3	637	Alcohol oxidase 2 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EXJ66180.1.