CAZyme Information: EXJ63431.1

Basic Information

• Species: Cladophialophora psammophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora psammophila
• CAZyme ID: EXJ63431.1
• CAZy Family: AA3
• CAZyme Description: DUF1929 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:W9WFS7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
766	AMGX01000026|CGC1	83823.19	6.6477

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CpsammophilaCBS110553	13421	1182543	0	13421

• Gene Location: location=AMGX01000026:151100-153481(+)

Full Sequence      

MRKLSTISIIYSYKTPSFLDSPLNASNLDLEFHYSRWVPEVPFNLQNVAVHASLLPTGKV
LYWGRRSNPKDTNPASLDQLFTKSFLWDPLTHASEPIAKEPLGMDGKSVNLFCSGHCFLP
DGNLLVVGGHIKDGFGVNQACVYDFKANAWFTKPMMNKGRWYPSALTLPDGRVLSISGSI
DGFGDSHVNNIPQIGPTEVSNANGWIEVTDPFPEVNVILPLYPRLHLDPKGRVFMAGPQE
QSWFLDITDANGVDIKKEIKNAKGVDNKTAQKTVGTWTDAKTARKAKFRDYAPSVMYATG
QIMYVGGGTDTTGPTNETELIDLNKNPPQWTTSGSMNNKRKQFNATILPDGTVLVTGGTR
GTSFNELRDRVNGPVHEAELWNPSGPSANTWTPMAAESADRCYHSIALLLLDGRVLSAGG
GEYGGITPDDCLTNAQLFEPPYLFNVPPEISYGKEFEISVGANDSIDKISWVRLGSVTHC
RNMNQSLMFLDFKPNGSKITVRAPANANIAPPGHYMLFVLNKQGVPSMAPIVRIARAPAP
APAGTPTPSTRVADVAQHIATAIKQLQPSLSEHNERIIAEQARPPVVVGLTPLCPYGLGP
CWSGAYDALQQVTDIEVVRPVANNIDSVAFVYLQRDILPDIDVWRSEFERIVHKAYDMRG
IEMTLSGVVTKKRVGADDQLTLAGTATRPDLVLEPFQATNQILWDKEAKAPKPITDAEAG
AYAKLSTALADHATGATMQITGWLQKYGANKFSLHVRKFEEAEETH

Enzyme Prediction     

No EC number prediction in EXJ63431.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	44	549	2.6e-125	0.36768149882903983

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199882	E_set_GO_C	7.04e-33	441	534	7	103	C-terminal Early set domain associated with the catalytic domain of galactose oxidase. E or "early" set domains are associated with the catalytic domain of galactose oxidase at the C-terminal end. Galactose oxidase is an extracellular monomeric enzyme which catalyzes the stereospecific oxidation of a broad range of primary alcohol substrates and possesses a unique mononuclear copper site essential for catalyzing a two-electron transfer reaction during the oxidation of primary alcohols to corresponding aldehydes. The second redox active center necessary for the reaction was found to be situated at a tyrosine residue. The C-terminal domain of galactose oxidase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
401164	DUF1929	1.09e-28	447	534	3	91	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.
276965	Kelch	7.69e-08	316	440	26	127	Kelch repeat. Kelch repeats are 44 to 56 amino acids in length and form a four-stranded beta-sheet corresponding to a single blade of five to seven bladed beta propellers. The Kelch superfamily is a large evolutionary conserved protein family whose members are present throughout the cell and extracellularly, and have diverse activities. Kelch repeats are often in combination with other domains, like BTB and BACK or F-box domains.
276965	Kelch	1.46e-04	121	179	10	66	Kelch repeat. Kelch repeats are 44 to 56 amino acids in length and form a four-stranded beta-sheet corresponding to a single blade of five to seven bladed beta propellers. The Kelch superfamily is a large evolutionary conserved protein family whose members are present throughout the cell and extracellularly, and have diverse activities. Kelch repeats are often in combination with other domains, like BTB and BACK or F-box domains.
276965	Kelch	0.002	340	420	1	65	Kelch repeat. Kelch repeats are 44 to 56 amino acids in length and form a four-stranded beta-sheet corresponding to a single blade of five to seven bladed beta propellers. The Kelch superfamily is a large evolutionary conserved protein family whose members are present throughout the cell and extracellularly, and have diverse activities. Kelch repeats are often in combination with other domains, like BTB and BACK or F-box domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ54416.1|AA5	2.25e-212	34	765	7	712
UKO99090.1|AA5|CBM42	4.80e-70	50	538	40	497
BAY23246.1|AA5|CBM42	3.02e-67	50	538	49	506
QNN54321.1|AA5|CBM13	2.38e-63	37	534	117	578
AGL16794.1|AA5|CBM13	1.56e-61	48	575	112	608

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WQ8_A	7.59e-41	36	536	182	661	Chain A, GALACTOSE OXIDASE [Fusarium graminearum]
2EIC_A	1.11e-40	36	536	160	639	Chain A, Galactose oxidase [Fusarium graminearum]
1T2X_A	1.49e-40	36	536	160	639	Glactose oxidase C383S mutant identified by directed evolution [Fusarium sp.]
2EID_A	2.01e-40	36	536	160	639	Chain A, Galactose oxidase [Fusarium graminearum]
1GOF_A	2.71e-40	36	536	160	639	NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],1GOG_A NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],1GOH_A NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],2EIE_A Chain A, Galactose oxidase [Fusarium graminearum],2JKX_A Chain A, GALACTOSE OXIDASE [Fusarium graminearum],2VZ1_A Chain A, GALACTOSE OXIDASE [Fusarium graminearum],2VZ3_A Chain A, Galactose Oxidase [Fusarium graminearum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CS93|GAOA_GIBZA	2.03e-39	36	536	201	680	Galactose oxidase OS=Gibberella zeae OX=5518 GN=GAOA PE=1 SV=1
sp|I1S2N3|GAOA_GIBZE	2.72e-39	36	536	201	680	Galactose oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GAOA PE=3 SV=1
sp|D4AUF1|WSCD1_ARTBC	3.86e-28	110	538	482	907	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1
sp|Q3HRQ2|GLOX_VITPS	7.60e-20	24	534	23	521	Aldehyde oxidase GLOX OS=Vitis pseudoreticulata OX=231512 GN=GLOX PE=2 SV=1
sp|Q9FYG4|GLOX1_ARATH	1.69e-17	100	534	169	614	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000001

TMHMM  Annotations     

There is no transmembrane helices in EXJ63431.1.