CAZyme Information: EXJ53449.1

Basic Information

• Species: Cladophialophora psammophila
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora psammophila
• CAZyme ID: EXJ53449.1
• CAZy Family: AA1
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:W9W4D6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
839	AMGX01000046|CGC1	92212.63	6.5448

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CpsammophilaCBS110553	13421	1182543	0	13421

• Gene Location: location=AMGX01000046:80384-83427(+)

Full Sequence      

MGEAGHRLESILHHLTLPETISLLSGKDTWHTASIPHRGIPSIRVSDGPSGVRGRRTFQA
SPTTCFPCPIALASTWDVNLVKEIGTQMAGQAKAQGVHVILTPTINIQRSPLGGRNFESF
SEDPVLSGSLACSLVSSIQHEGIATTVKHFVCNDQESQRTKIDVIVEERALREIYLKPFQ
IVVRNARPWAIMASYNRVNGLHVSENPHLLEKVLRREWGWDGAIVSDWFATYSTSEALNA
GLDLEMPGKAEWRGKLVMRSLHAGKLEAPVLQQRARNVLNLVDKTRASGVPEDAEEWENN
TPEVREANRKAATESVVLLKNAAKLLPIRAPGRVVIIGPNAKEDLYCGGGSSTVFPYYYI
SAYDGIKRALEQQSPSSELAFAQGCYKHALLPLLCTESADGQKGLDLQFFDRDFTQTSDA
QKIAGTRSLTWRLVFLDSLPKAALPSVYGHFSGVYIAPSDGDFEFGVVTTGKAKLYIDGV
LLVDNWTKQERGDHFFGLGTKEVRGTIKLTAGCQYKVVTEYSNMSSLSDRTAADLAGGIL
RLGVSQVISPEALLNDALEAAALADTVICCIGTDQEHESEGWDRKDMKLPGSQDQLVKAV
LEANPRTVIVNISGSPVEMPWIDEASTVVQGWFMGSELGNALGDVLFGRVSPSGKLSVTF
PRRLEQNPSYGNFPGENGRVRYAEGIMVGYRHYSTRHIPTLFPFGHGLSFTEFKYSELLF
EGDNMLHPNGVVSVSLTLTNIGNFTSHEIVQLYVSALTCSTFRPLLELQGFQKVRDVQPG
ESRKVTFNIDKYAVSCYDERQDNWMAEAGKYRVSVGASVGDLRLATFIQVPATFHWSGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	247	3.9e-68	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.46e-76	64	827	118	762	beta-glucosidase BglX.
224389	BglX	2.81e-66	30	357	50	376	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.71e-47	316	690	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	2.72e-41	39	281	65	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	2.78e-36	7	790	52	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD55191.1|GH3	1.58e-251	3	839	17	851
UPK92097.1|GH3	3.95e-248	8	839	17	846
BCS12335.1|GH3	3.29e-244	4	839	18	846
BCS00565.1|GH3	3.29e-244	4	839	18	846
QQK43365.1|GH3	1.08e-243	8	839	6	840

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	9.98e-213	8	839	6	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.13e-208	8	839	6	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	6.23e-157	8	833	5	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.98e-129	12	830	9	663	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	6.76e-113	7	824	3	707	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U8Y5|BGLI_ASPOR	1.20e-242	8	839	6	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	2.40e-242	8	839	6	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|A1CA51|BGLI_ASPCL	2.64e-241	8	839	6	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q0CAF5|BGLI_ASPTN	1.09e-240	8	839	6	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	7.71e-238	8	839	6	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000006

TMHMM  Annotations     

There is no transmembrane helices in EXJ53449.1.