CAZyme Information: ETI28871.1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: ETI28871.1
• CAZy Family: GT39
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346	KB822697|CGC11	39440.27	6.9671

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiCBS160.54	10428	1279043	55	10373

• Gene Location: location=KB822697:3717329-3718421(+)

Full Sequence      

MGSGLGTNTSTGSGSTSHTSSWRHSHKKQAKSLRPVELMKRPISRDLQAIPKLIHQSWSS
TELPAKFERWSATCRQQHPDWEWVLWTDEDNEELVRTHFPWLLKTYLGLPGVIYRADLVR
NLYMYMFGGVYADLDVECLRPQDQMFAEFNVSTITHGKPKSQAPNLPKSGRKAFFGRMGT
DTGSSNSIPNAWMASTPGHPFFLIVLESVMKQMSEGDTDSVEGATGPGKLYDMINEYNEP
EGKWVGEALDKHVAKNPTAKQFNPRKGLKHSVEVLPFQYIYPYSWERDGEAFREICWATK
NDFSAERCKQLLATDHWPSYTITYWSHTWTSGGHDEGNVQKLDQDQ

Enzyme Prediction     

No EC number prediction in ETI28871.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	69	145	2.7e-18	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.74e-29	25	227	57	233	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.92e-15	73	148	10	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO66576.1|GT32	3.17e-104	29	342	77	410
QLI72987.1|GT32	3.12e-89	30	342	50	358
UKZ71055.1|GT32	3.85e-88	25	345	72	373
ANH56535.1|GT32	1.04e-86	30	342	84	376
BCS29894.1|GT32	4.25e-74	35	329	73	380

PDB Hits     

ETI28871.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	1.28e-24	44	209	51	188	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P33300|SUR1_YEAST	3.47e-21	48	288	53	254	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	4.14e-21	46	211	60	201	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P38287|CSH1_YEAST	4.46e-21	48	227	60	213	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	3.86e-20	50	211	82	215	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ETI28871.1.