CAZyme Information: ETI28795.1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: ETI28795.1
• CAZy Family: GT35
• CAZyme Description: Cellulase domain-containing protein [Source:UniProtKB/TrEMBL;Acc:V9DPI2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393	KB822697|CGC17	44895.99	7.8163

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiCBS160.54	10428	1279043	55	10373

• Gene Location: location=KB822697:3509164-3510345(+)

Full Sequence      

MARILWYRGSTPANLSLYPDAELIKANVTVPHDRGIRPINPPLSTRGRDIIDRDGRRIKL
VSVNWYGASDVDMVPGGLSVQNRTEIARIIRELGFNSVRLPYADELVHKNPLIDPKHLSA
NHDLIGLRALDVYAALVRTLTEAGLAVIVNNHITEARWCCDGNPCDMGWKNSDLGPFCPV
RQTEEDWVQDLLSVMEPHINDPLVVGVDLRNEVRGFAGRLMWNSWASAAERASERLHRLQ
PEWLMIVEGVQSANDIRGAKDRPVRLVRQNKVVYSSHVYGWSGWGSLVPYWYRTYKSFAA
DMATNWGYLLQTDTAPVWVGEIGAPNSPSRRDYHYWKNLMKYLRESDADFAYWAINPRKP
GSNSVESYGLLHDDWQTPVYDYRLLDMARLRQK

Enzyme Prediction     

No EC number prediction in ETI28795.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	50	360	5.8e-145	0.9873015873015873

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	1.38e-15	84	357	27	270	Cellulase (glycosyl hydrolase family 5).
225344	BglC	3.35e-12	89	393	81	399	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPC75002.1|GH5_24	5.51e-161	42	390	51	400
CZS75738.1|GH5_24	1.86e-160	42	390	148	497
QPC66231.1|GH5_24	2.64e-160	42	390	148	497
UKZ85745.1|GH5_24	2.91e-158	42	393	153	505
CEI64186.1|GH5_24	1.51e-157	42	390	150	499

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ECE_A	1.46e-43	45	377	8	338	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
1VRX_A	2.85e-43	45	377	8	338	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]
3W6M_A	1.73e-27	58	390	28	375	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3VVG_A	2.38e-27	58	390	28	375	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3AXX_A	2.43e-27	58	390	61	408	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54583|GUN1_ACIC1	2.65e-41	45	377	49	379	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P23548|GUN_PAEPO	9.47e-40	45	377	41	369	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|C0HLA0|GH5FP_CHAOB	1.02e-33	42	389	30	396	Glycosyl hydrolase 5 family protein OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1
sp|P10474|GUNB_CALSA	3.04e-28	43	377	630	984	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1
sp|P50400|GUND_CELFI	4.99e-27	43	377	46	400	Endoglucanase D OS=Cellulomonas fimi OX=1708 GN=cenD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000004

TMHMM  Annotations     

There is no transmembrane helices in ETI28795.1.