CAZyme Information: ETI26719.1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: ETI26719.1
• CAZy Family: GH78
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:V9DII7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	KB822700|CGC2	39050.92	4.8862

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiCBS160.54	10428	1279043	55	10373

• Gene Location: location=KB822700:29252-30437(+)

Full Sequence      

MPARGVSFADRTEQDTPVLRVDSTANAGRTNEEQAVRSATVPERLAAKPTATSNDRANGN
GGIGQIQGVANDQVSHDDPKPDDGNAGEHQVSCDDGDVTGRDGAWVVPGVGTFQKRALYT
FDGLSLPAGLHKSNYTVQSRRVGYGNPQIPYNERFDPANVQLRNGFLTLTVPGGQQPTQA
DNYAIRCAEITTVDQNILYASVRTKAIFCQEPGTIHAGLFFYKSDTQETDIEYLTDPSSL
SNPGPGVPVPMWYTNQAVDPQNMAKTYQTGNAPTDCTTNVHEYRLDWTKDFTAFYIDGVL
QKKFWVNIPSVPGTWVWNNWANGDRGWSAGPPARDNVFRIQSITMYYNTAGNASSGSV

Enzyme Prediction     

No EC number prediction in ETI26719.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	169	346	1.3e-36	0.90625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	4.02e-30	119	346	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185692	GH16_fungal_CRH1_transglycosylase	0.003	271	331	108	189	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185694	GH16_CCF	0.003	250	325	182	258	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
395585	Glyco_hydro_16	0.005	268	322	92	157	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62486.1|GH16	2.67e-66	101	350	35	263
QPC71194.1|GH16	6.16e-65	103	350	38	264
QGI87979.1|GH16	1.19e-64	101	350	35	263
CCT75335.1|GH16	1.19e-64	101	350	35	263
QGJ01524.1|GH16	1.68e-64	101	350	35	263

PDB Hits     

ETI26719.1 has no PDB hit.

Swiss-Prot Hits     

ETI26719.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999714	0.000314

TMHMM  Annotations     

There is no transmembrane helices in ETI26719.1.