CAZyme Information: ETI25715.1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: ETI25715.1
• CAZy Family: GH51
• CAZyme Description: CAP10 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:V9DFS4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
663		76055.37	7.0404

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiCBS160.54	10428	1279043	55	10373

• Gene Location: location=KB822703:1186207-1188198(+)

Full Sequence      

MSIYLTALTTMIPAFKFIWSHKNPFPPMPISTTTFAFLLIFFGRWIYRRVQQALGEKDPM
RNSRQVFLFIILCILLSPAWRKKDYTHFHPIDMLMYDAKLHHDRYLETVGDTASLGETVA
RYRQRYNRSPPPDFDVWFEFAKNKSALIVDEFDQIYDDLLPFHAIAPADLRRQTWEMVSN
PWNEISGITIRNGEAKVQENVLPTHRWMLEGVAVLINSFAQYLPDMDLAFNLNDESRVAV
PYERIQHLRQQARSQDNTGHSSWSADRAAGWLPIPEHEYRETVFRENSWRNSFRTFGSAG
CPPSSLARSSPHISSHSHLCGPCVAPHSLGQFLANWTDAADICHQPDMAHLHGFYLSPAA
FKASYQLMPVFSQSKPHGYNDILYPSAWNYMDKVVYKPVPPSGTPGTEDANPGFPDPPFS
AKKNVLFWRGATSEGVSSESAAWRGMTRQRLVHMSHNLTTHPHDKVTILLPNPADHTKYK
YQTLPGPAVKQLGLTTDIAIVDFIARCGGHDCDDQKAEFALLPPSDFQAHWGFKYLFDLD
GAGFSGRFLPFLQSHSLPFKTALFREWYDSRLTAWLHFVPQDTRLHSVWSTLAYFAGVDG
TMWGQKIWWKGHDAEGEMIAEAGREWAAKVLRKEDMECYFFRLLLEWGRLTDDRRDELGF
VVP

Enzyme Prediction     

No EC number prediction in ETI25715.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	346	651	3.4e-70	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	3.53e-15	369	650	32	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.76e-08	369	650	108	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO14774.1|GT90	2.81e-227	19	660	355	1003
QVM13461.1|GT90	4.99e-216	1	660	309	963
USW54735.1|GT90	1.82e-215	2	660	328	983
CAK36993.1|GT90	1.84e-215	18	660	355	993
BCR84315.1|GT90	3.68e-215	18	660	360	995

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	1.90e-07	346	663	95	357	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	2.32e-42	76	656	139	661	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	6.29e-07	346	663	123	385	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1
sp|Q8NBL1|PGLT1_HUMAN	1.10e-06	346	663	123	385	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	4.62e-06	530	657	279	397	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q9JHP7|PLGT2_MOUSE	5.55e-06	526	650	358	466	Protein O-glucosyltransferase 2 OS=Mus musculus OX=10090 GN=Poglut2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000006

TMHMM  Annotations     

Start	End
25	47
66	80