CAZyme Information: ETI24875.1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: ETI24875.1
• CAZy Family: GH35
• CAZyme Description: Mannan endo-1,6-alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:V9DDG4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459	KB822704|CGC5	49677.74	4.6509

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiCBS160.54	10428	1279043	55	10373

• Gene Location: location=KB822704:2341244-2342674(+)

Full Sequence      

MPGLVLSVIIFLGFLSRTAVGIALDVDDTESILAAAALGAHKVIGLYSGNQTGGTQGKWP
FPPYYWWESGGAWGGLMEYWHYTGDDTFNEVMQTALIAQLGPKNDFNVPAEAFDTGNDDQ
AFWVFVAMAAAEYSFPQLPAPNPSWIQIVNNAWQDYVFRWNTSGCNGGLKWQFNPNNAGY
YYKNSISNGAFFQLSARLARFTGNETYVHWAETVWNWAWGIGLIDSIYNVYDGTDELINC
TGIDHHQWSYNVGAFLYGAAVLQNFTNGSSPWIDRTAGLLAATNTFISPFQNASNIIFEA
ACELSNTCNTDQLSMKAYLIRWLAATSKMAPFTAGRIGDVLRASAQGAAASCTGGKTRNT
CGSKWYLGRWDGTTGLGQELCALEATYALLVNQTNPPAVYHNVGISTAAPSPTIPVTATD
GLPAASDSARPLHDGAPATPSTMQTKVLIAALFTSLTIM

Enzyme Prediction     

EC	3.2.1.101:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	29	394	1.6e-84	0.946927374301676

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	8.18e-146	31	383	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	3.32e-06	118	290	93	251	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS76159.1|GH76	6.33e-167	18	452	13	455
BCR93001.1|GH76	2.64e-130	22	407	29	412
BCS05661.1|GH76	2.64e-130	22	407	29	412
QSZ36627.1|GH76	4.21e-129	16	411	19	408
APA11655.1|GH76	3.39e-128	22	411	24	407

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.83e-91	26	411	30	423	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6FLP9|DCW1_CANGA	1.36e-103	13	407	9	399	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|P36091|DCW1_YEAST	2.11e-103	14	384	14	379	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	3.16e-103	12	411	12	408	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|O74556|YCZ2_SCHPO	6.05e-101	19	411	17	405	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	1.13e-94	7	427	4	425	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000267	0.999707	CS pos: 21-22. Pr: 0.9697

TMHMM  Annotations     

There is no transmembrane helices in ETI24875.1.