CAZyme Information: ETI24213.1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: ETI24213.1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
955	KB822704|CGC18	108046.16	6.1449

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiCBS160.54	10428	1279043	55	10373

• Gene Location: location=KB822704:540100-542967(-)

Full Sequence      

MVKHHDFKRCDQSGFCRRNRALADTMLARGNSDSSPYQLDAASIKYKDGRLDASIIKSLS
GGDAVKLPLTITFLDRGNVRIIIDEEKRKKGDIELRHGSAARKERYNEAGAWALTGAGLQ
PEKAAYMRRKGVTEVTWGPDGRFKAMIRHAPFGVEFWSGDEKQVVFNGQGFLNIEHWRSK
VDKPPRDENSTDPEPTEPAEDESTWWEESFGGNTDSKPRGPESVALDISFPGYGHVYGLA
EHAGPLSLKETRGGEGNYDQPYRMFNSDIFEYELDSPMTLYGSIPFMQAHKKDSTVGVFW
LNAAETWVDITKSKHDTNPLTLGLTGGIVDTHTHWMSESGLLDVFVMLGSTPKDLSKSYS
ELTGYTAMPASFAIAYHQCRWNYVSDEDVKDVDRKFDKFNIPYDVIWLDIEYTNEKAYFT
WDPLNFPDPISMEKQLDETERKLVVIIDPHIKNKEGYHVVEELKSKDLAVKNKDNNIFEG
WCWPGSSSWIDSFNPAARSWWKSLFSYDRFKGTQSNVWLWNDMNEPSVFNGPEISMPRDN
IHHGNWEHRDVHNLYGLAFHNATYHALLERKKGETPRRPFVLTRSFYAGSQRSAAMWTGD
NQANWEHLVASIPMILNQGVSGFPFAGADIGGFFGNPSKELQTRWYQAGAFYPFMRGHAH
IDTRRREPYMLGEPYTSIMTQALRLRYSLLPAWYTAFHEAATEGYPIVRSQYFVHPGDER
GFAIDDQMYLGSSGLLVKPVTQEGGESVDVYIADDENYYDYFDYTVYSGRAGRTHTVSAP
LDKIPLFMQGDHIVPRKDRPRKSSGLMKWDPYTLVVVLDKKGERAEGTLYVDDGETFDYQ
LGAYIHRNFSFENGELKSTDIGKKGAKTIAYLKTMKDVKVEKIIVVNAPAPWSSVGEVTV
TEDGVRGSRQVELIYHAPTAGKAAWAVVRNPATPVGVDWSISFPGPSESAVKTEL

Enzyme Prediction     

EC	3.2.1.20:27	3.2.1.84:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	345	794	2.9e-151	0.9953161592505855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224418	YicI	0.0	128	881	70	761	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	0.0	345	794	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269889	GH31_GANC_GANAB_alpha	0.0	364	836	1	467	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
269890	GH31_glucosidase_II_MalA	5.35e-145	364	704	1	339	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
215408	PLN02763	6.16e-111	350	845	164	644	hydrolase, hydrolyzing O-glycosyl compounds

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK40395.1|GH31	0.0	2	943	25	957
CAS97680.1|GH31	0.0	2	943	25	957
ACF60497.1|GH31	0.0	2	943	25	957
BCR98911.1|GH31	0.0	2	943	31	963
BCS11223.1|GH31	0.0	2	943	31	963

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DKX_A	0.0	1	943	4	950	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DKY_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5JQP_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
5DKZ_A	0.0	1	943	4	950	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DL0_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
5IEF_A	1.23e-243	2	941	1	909	Murine endoplasmic reticulum alpha-glucosidase II with N-butyl-1-deoxynojirimycin [Mus musculus]
5IEG_A	1.27e-243	2	941	1	909	Murine endoplasmic reticulum alpha-glucosidase II with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]
7KRY_A	6.69e-243	2	941	32	940	Chain A, Neutral alpha-glucosidase AB [Mus musculus],7KRY_C Chain C, Neutral alpha-glucosidase AB [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9US55|GLU2A_SCHPO	1.42e-288	5	883	29	881	Glucosidase 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gls2 PE=1 SV=1
sp|Q8BHN3|GANAB_MOUSE	1.72e-242	2	941	33	941	Neutral alpha-glucosidase AB OS=Mus musculus OX=10090 GN=Ganab PE=1 SV=1
sp|B9F676|GLU2A_ORYSJ	4.35e-242	3	941	30	916	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1
sp|Q9FN05|PSL5_ARATH	4.63e-242	3	861	22	845	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1
sp|Q94502|GANAB_DICDI	3.74e-241	205	899	234	909	Neutral alpha-glucosidase AB OS=Dictyostelium discoideum OX=44689 GN=modA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ETI24213.1.