CAZyme Information: ETI23672.1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: ETI23672.1
• CAZy Family: GH17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
793		90149.47	5.0797

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiCBS160.54	10428	1279043	55	10373

• Gene Location: location=KB822705:2255315-2257696(-)

Full Sequence      

MLSCPRGVVALRSFLVCVATLLLFSFPPIHASNDTLLWGPYRPNLYFGVRPRLPNSLLTG
LLWANTDSYASTQQNFRYTCEQHEGMAGYGWEEYDARNGGRQVIHDTGNKIDLTIDFVKV
PGGQHGGSWAARIKGTPREDAPDNIVTTLVFYAAMEGLGELGFKDTDAEPDSVTLHGETG
DLGSFDIYFGDPSENLLPYKTHPSWDLKPLDRPVLSSVQVPSEAIWQAKNIVFASMKGEI
EDLVQQYGQENMPPPWQAFAIKHDPQAGNFHMVQRIFVGGFETDILFSSASGPPVTSETL
TQAIADSSKSFKTKFREVFKPLAPFTKSVYTDFSESMFSNLFGGIGYFYGDSLVDRSYAP
EYDEDNEGFWEETAAARARAEIVKDPPAELFTSVPSRPFFPRGFLWDEGFHLIPIAEWDL
DVTMDIVKSWFNLMDQDGWIAREQILGAEARSKVPVEFQVQYPHYANPPTLFLIIDTLMD
KSSDPTYASSRDRIMSELRHLYPLLKRQYYWFRRTQHGDIKSYDREAFSTKEAYRWRGRT
PQHILTSGLDDYPRPQPPHPGELHTDLISWVGMMSRTLLRLSTLLDETDDIPDFTTQHKA
LLRNIDDLHWSSEHECYCDATIDDYEDSIHVCHKGYISIFPFMTGLLPPDHKHLPDILAL
IANDQELWSPYGIRSLSKSSPFYATDENYWRSPIWVNMNYLILRALLSTATAAHAPAKVK
TQATTLYRDLRKNLVDTVFHEWQRTGFAWEQYNPETGEGQRTQHFTGWTSLVVVIMRMPD
LAGDGGGIKHSEL

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	563	777	5.7e-31	0.43157894736842106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	296	778	2	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	2.62e-116	36	254	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	6.62e-10	440	708	304	550	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
236653	PRK10137	3.63e-04	650	770	668	773	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVM12625.1|GH63	0.0	30	793	42	818
BCS02288.1|GH63	0.0	31	793	39	822
BCS13967.1|GH63	0.0	31	793	39	822
CAL00956.1|GH63	0.0	31	793	39	822
QGA12606.1|GH63	0.0	31	793	35	818

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	1.69e-159	32	776	11	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	1.72e-130	25	776	23	775	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	7.51e-229	31	776	37	804	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	1.63e-158	32	776	41	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	5.85e-131	25	776	78	830	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	2.44e-125	23	776	74	833	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5
sp|O88941|MOGS_RAT	8.76e-125	25	776	78	830	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000350	0.999624	CS pos: 31-32. Pr: 0.9754

TMHMM  Annotations     

Start	End
7	29