CAZyme Information: ETI23267.1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: ETI23267.1
• CAZy Family: GH16
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:V9DBC1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
770	KB822705|CGC6	83107.90	4.5053

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiCBS160.54	10428	1279043	55	10373

• Gene Location: location=KB822705:1093587-1095954(+)

Full Sequence      

MAGVLLCLLALDISTASSAVLLPRQGDSTWQDTGLPAAQRADALLPQLSWEEKIAQMGGI
RRLLGANATFNRTAWDALYPLQHGILSYGSQLNQAQDVLPYANMVREEQLNSSQVPWITV
TDSVNSIYVPGGTLFPATLSLSTSWNLPLYEEVVAAIRDENMALGTHWVLSPELDIAKEP
RNGRVGEMYGEDVYLVGEFAAQYVKTMQERDEGGRMKVATTVKHFLYGQGLGGVNTASMD
GGVNHLYNDLAIPYIRALKENPASIMISYSSIDRIPMSMNTALIQNMLRTEMGFTGLVMS
DAMGILHLYTESKVASSYKDAAIKALRAGLQLELAPGQPACFPYLVNSSDDQEIVDLVNE
AARQNLIIKFDTGMFDLPLPTMENLDRTLRAPQHLDVNRRASREAIVLLSNDGFLPQANL
SQVALIGPFGDILDPGSYAPTTSANPEYGRTLKGSLEARMGAESVRYVKGVGIRTTSPND
TAGIQEAVAAARAAGVAIVSLGSLSVYSQDAAVNERTDGEFYSHASLAFPGSQQQLLDAV
LDTGVPTVLVLNGGQAFVLNNSTMRSSAILHQFLGGEFSSDALVEIITGQVNPSGKLTIS
MPQADGAFPIYYDFLLSDNVGGGTANPADPSVCAGDWNLPCLNRDGAPMAFGYGLSYTTF
DLSAPEILSNSSGVSISCTVTNTGNMAGKEVVQVYFRQQFSDIELPNKRLIHFQKVELQP
GEAHQVEFAIEKADLGYYNNAKYQVDSGNYTFWVGSSSRMSDLKNATISL

Enzyme Prediction     

No EC number prediction in ETI23267.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	112	334	1.7e-47	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.43e-90	6	770	4	764	beta-glucosidase BglX.
224389	BglX	8.39e-50	130	453	78	386	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	5.99e-43	4	731	10	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	7.00e-39	51	363	3	311	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	1.95e-26	406	619	1	207	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60600.1|GH3	0.0	9	770	9	771
CCT75117.1|GH3	0.0	9	770	9	771
QGI87496.1|GH3	0.0	9	770	9	771
QGI70133.1|GH3	0.0	9	770	9	771
QGJ01022.1|GH3	0.0	9	770	9	771

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	3.09e-81	30	758	7	745	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	2.19e-80	30	758	7	745	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5XXL_A	4.66e-75	42	770	15	751	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	2.35e-74	42	770	15	751	Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	1.93e-73	42	770	14	750	Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KMH9|PLH34_FORAG	8.70e-76	30	758	29	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
sp|Q56078|BGLX_SALTY	1.75e-72	133	758	118	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	7.64e-71	128	770	83	722	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|P33363|BGLX_ECOLI	1.59e-70	13	758	7	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|A7LXU3|BGH3B_BACO1	2.70e-58	45	755	43	762	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000373	0.999607	CS pos: 18-19. Pr: 0.8926

TMHMM  Annotations     

There is no transmembrane helices in ETI23267.1.