CAZyme Information: ETI22472.1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: ETI22472.1
• CAZy Family: GH128
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415	KB822706|CGC1	47249.18	8.0042

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiCBS160.54	10428	1279043	55	10373

• Gene Location: location=KB822706:1988828-1990254(+)

Full Sequence      

MLLPKGGVTWKSAKARLPPWKAIIMFLTRTRFLVAVALTGLIILLWRGISVSTQQMSNFY
CFGPSKPPTQMTKNEMAAWNQHLQTPVLFNHHEPYQVNASTIERIDLNPIVSTPRALSNK
ERVLILTPLRDAAPYLIKYFDLLSELTYPHDLIDLAFLVGDSVDDTLAVLSAELNRIQQR
TDKIPFHSVLIVEKDFGSNLDMNVESRHGFAAQGPRRKAMGRARNYLLSAALKPEHSWVY
WRDVDIVDSPKKIIEDFVAHDRDILVPNIWFHRYENGRDIEGRFDYNSWIESDKGRRLAS
SLDKNVVLAEGYKEYDTGRTYMARMGDWRHNKDEEIELDGIGGVNILVKADVHRSGINFP
CYAFENQAETEGFAKMAKRAGYQVVGLPNYVVWVRPVSPHAISLGSHIDVVPSLF

Enzyme Prediction     

No EC number prediction in ETI22472.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	100	362	2.1e-107	0.9850746268656716

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	3.53e-160	101	363	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD70999.1|GT62	6.42e-239	1	393	1	393
UQC85603.1|GT62	2.37e-234	1	393	1	393
QKX56390.1|GT62	1.25e-233	1	393	1	394
CDP26346.1|GT62	3.64e-233	1	393	1	391
CAP73945.1|GT62	3.64e-233	1	393	1	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	5.64e-61	102	393	6	298	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32629|ANP1_YEAST	3.80e-92	88	393	48	353	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O74745|ANP1_SCHPO	1.60e-91	100	393	75	370	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P23642|VAN1_YEAST	6.99e-77	100	393	170	510	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	1.54e-71	100	393	74	417	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P53697|MNN9_CANAL	1.68e-63	102	393	73	364	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000019	0.000006

TMHMM  Annotations     

Start	End
32	49