CAZyme Information: ETI21403.1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: ETI21403.1
• CAZy Family: CBM21
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358		37771.71	3.8800

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiCBS160.54	10428	1279043	55	10373

• Gene Location: location=KB822707:2164079-2165279(+)

Full Sequence      

MKFSCLVAVTATLVLSATPVLSQDEFTTLDVDPGAEPVPTQYDEPVPEEGSEYEYTGDED
YWHGHPHLPEDCNDIRIFSARGSDEPYPGRGGTMLGVMCYLFESVGLSCDYEDVVYPANI
SYSGLFCQSANIGASRGQTQMAAYVERCPNSRLVLTGYSQGGSVVGDILGGGGGPIFGCD
QPWNPSMPRSTAPGSSIVAVVTFGDPRFTVNQAYNIGRGSGYSGVLAREGQQLADLNQYD
DILAMWCNAGDPVCAVGSEPVNITAHWSYYDEYTDVASRWVVATALGQSDVRLDLDLDGQ
NESVVLMGRNSSRNGNDSESGSGGGDEDGGVSLRGSPSGGIGVVGLVALITAGLVCML

Enzyme Prediction     

No EC number prediction in ETI21403.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	72	283	9.7e-42	0.9788359788359788

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	6.29e-20	72	283	2	171	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ54783.1|CE5	3.37e-69	71	294	49	279
QBZ64457.1|CE5	3.69e-64	72	289	52	272
CZS83092.1|CE5	7.67e-64	72	281	31	230
QPC60696.1|CE5	2.43e-62	72	281	31	230
QGI63982.1|CE5	2.72e-61	72	283	31	232

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2AXE_A	8.54e-14	72	281	2	202	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
1BS9_A	1.17e-13	72	281	2	202	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	1.17e-13	72	281	2	202	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
1QOZ_A	2.95e-13	72	281	2	202	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]
4PSC_A	8.93e-09	72	282	79	244	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A2J8C362|CUTI1_VERDA	5.15e-16	70	281	23	225	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|O59893|AXE2_TALPU	9.25e-13	72	281	29	229	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|O06319|CULP4_MYCTU	1.12e-12	72	283	47	224	Phospholipase Culp4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut4 PE=1 SV=3
sp|Q99034|AXE1_HYPJE	5.08e-12	72	281	33	233	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|P0A537|CULP3_MYCBO	1.53e-11	72	282	44	223	Probable carboxylesterase Culp3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=cut3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000217	0.999760	CS pos: 22-23. Pr: 0.9769

TMHMM  Annotations     

There is no transmembrane helices in ETI21403.1.