CAZyme Information: ETI20872.1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: ETI20872.1
• CAZy Family: GT90
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
289	KB822707|CGC10	31024.04	3.8977

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiCBS160.54	10428	1279043	55	10373

• Gene Location: location=KB822707:717083-717952(+)

Full Sequence      

MKSSQLVALAAATISGADAYFRGFNIGANLPSGACRSQSDWEFAFNKIASFPGNFNSARL
YASSDCNTLANAVPAALNTGTTLLVGVWTEDNNHYEAEKQALLEAIQQYGHDWILAVSVG
SEDLYRGDTDANTLASQINDVRGMLWGLGASDKSVGHVDTWTAWVDGANTPVIEAVDWLG
NDAYPYWEGVGIDNGASSDAYWAAVTKVRAVAQGKDVWTTETGQPISGDTVGNAVPSVES
LQTYWWQVSCASLNSLNYFFYDLDDFNASPSFAVVDSNYNPLIDMSCGA

Enzyme Prediction     

No EC number prediction in ETI20872.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	8.38e-42	3	274	20	294	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIW94742.1|GH17	1.56e-108	11	286	10	286
APA06410.1|GH17	3.96e-108	1	287	1	295
UJO17243.1|GH17	5.74e-104	1	285	1	286
CCD34315.1|GH17	6.78e-104	1	287	1	294
ATZ46547.1|GH17	6.78e-104	1	287	1	294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.57e-22	21	250	37	252	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.10e-21	21	250	37	252	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DJ47|EGLC_NEOFI	2.69e-61	1	289	1	312	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|Q4WG16|EGLC_ASPFU	3.45e-61	1	289	1	312	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	3.79e-61	1	289	1	312	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|Q2UUZ1|EGLC_ASPOR	4.29e-59	1	287	1	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|Q5AUT0|EGLC_EMENI	1.34e-57	4	289	5	313	Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000340	0.999660	CS pos: 19-20. Pr: 0.9479

TMHMM  Annotations     

There is no transmembrane helices in ETI20872.1.