CAZyme Information: ETI20843.1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: ETI20843.1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
739	KB822707|CGC6	83081.44	8.7819

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiCBS160.54	10428	1279043	55	10373

• Gene Location: location=KB822707:635597-637890(+)

Full Sequence      

MDPQQVNNPRVPEQTHPTAARSQSWVAADDYFLPAPPPVPASYSVNGERVYSPDTGGPST
PLPAYKRQMSSDSTSRSRTSTLRDRSLVDLNDGFVPAAAEEAMPFNIKYNSSCYTVERLA
DFDDLELRPTLVKAVHKLMPFVTVAALAASFGYFGFRIYCTLATQRARDKIYPMAWVFII
AETFVAFPQLFYAFYSFLALRSRKRPKLRLRGNAVPTVDVFVTCCKEDIDVILDTVRAAC
VIDYPRDRFRVVVCDDGGSEELRKAVGMLQTCYTNLLYWARVKVKGKPHHFKAGNLIAAT
DMVATLPEGPGEFIAALDADMIPEPEWLRTLMAHLVIDDQMSLVCPPQLFYNTPKGDPLF
QSLDSFARVQEVIKDANGVAWCTGSGYAVRRVAIESIGGWPTGSLAEDVFTSSMLLGHGW
KTAFVHEPLQWGLVPDTFTGHLKQRTRWTLGTLQTAAKLNFCLYGVGARGMTFSQRLSGF
LFPVDNLLRMFIAFAVVAIPVGLMSGKVLVLYVSEDQLRWQIRLCFLGFALGRLAEYITF
LPSGYRLARRDFDASLWMIPYNAITIVQSFILPKWLGGKPMAFAPTGSLTSELNERDIKQ
RAPLWKRLKIIIWDCKAYIHLVYVVFTVTAVALAFGRALSIKGDVSAQYRYILTHICWPP
MLWVLSAIAFTVPVRYAIWPPTVPDREELLDRDPDTFIAHPKRESKQTKWSKLTLFHEAV
YVAVTVYTTLAFVATLIWH

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	217	451	1.4e-22	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	5.36e-95	216	456	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	2.39e-42	174	579	12	423	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
236918	bcsA	2.04e-28	216	477	260	509	cellulose synthase catalytic subunit; Provisional
133045	CESA_like	2.07e-21	220	408	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133059	CESA_CaSu_A2	2.46e-21	230	451	14	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ49458.1|GT2	6.10e-263	96	733	135	778
CCD45106.1|GT2	6.10e-263	96	733	135	778
QSZ31828.1|GT2	4.54e-261	105	734	160	793
APA12172.1|GT2	6.36e-256	105	733	150	782
QDS68780.1|GT2	1.38e-245	52	735	28	713

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	1.57e-25	216	477	273	522	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	2.60e-24	153	574	68	487	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	2.99e-24	153	574	80	499	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	2.99e-24	153	574	81	500	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P58932|BCSA_XANAC	3.09e-28	146	477	86	402	Cellulose synthase catalytic subunit [UDP-forming] OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsA PE=3 SV=1
sp|P0CW87|ACSA1_KOMXY	5.66e-26	179	488	113	415	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1
sp|O82859|BCSA2_KOMSB	9.20e-26	164	477	91	400	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
sp|Q8Z291|BCSA_SALTI	1.13e-25	177	477	235	522	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
sp|Q93IN2|BCSA_SALTY	2.61e-25	177	477	235	522	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

Start	End
138	160
173	195
490	512
524	541
556	578
619	641
651	673
716	738